PDHX (NM_003477) Human Mass Spec Standard
CAT#: PH303138
PDHX MS Standard C13 and N15-labeled recombinant protein (NP_003468)
View other "PDHX" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | PDHX MS Standard C13 and N15-labeled recombinant protein (NP_003468) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203138 |
Predicted MW | 54.1 kDa |
Protein Sequence |
>RC203138 protein sequence
Red=Cloning site Green=Tags(s) MAASWRLGCDPRLLRYLVGFPGRRSVGLVKGALGWSVSRGANWRWFHSTQWLRGDPIKILMPSLSPTMEE GNIVKWLKKEGEAVSAGDALCEIETDKAVVTLDASDDGILAKIVVEEGSKNIRLGSLIGLIVEEGEDWKH VEIPKDVGPPPPVSKPSEPRPSPEPQISIPVKKEHIPGTLRFRLSPAARNILEKHSLDASQGTATGPRGI FTKEDALKLVQLKQTGKITESRPTPAPTATPTAPSPLQATAGPSYPRPVIPPVSTPGQPNAVGTFTEIPA SNIRRVIAKRLTESKSTVPHAYATADCDLGAVLKVRQDLVKDDIKVSVNDFIIKAAAVTLKQMPDVNVSW DGEGPKQLPFIDISVAVATVKGLLTPIIKDAAAKGIQEIADSVKALSKKARDGKLLPEEYQGGSFSISNL GMFGIDEFTAVINPPQACILAVGRFRPVLKLTEDEEGNAKLQQRQLITVTMSSDSRVVDDELATRFLKSF KANLENPIRLA myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003468 |
RefSeq Size | 2991 |
RefSeq ORF | 1503 |
Synonyms | DLDBP; E3BP; OPDX; PDHXD; PDX1; proX |
Locus ID | 8050 |
Cytogenetics | 11p13 |
Summary | The pyruvate dehydrogenase (PDH) complex is located in the mitochondrial matrix and catalyzes the conversion of pyruvate to acetyl coenzyme A. The PDH complex thereby links glycolysis to Krebs cycle. The PDH complex contains three catalytic subunits, E1, E2, and E3, two regulatory subunits, E1 kinase and E1 phosphatase, and a non-catalytic subunit, E3 binding protein (E3BP). This gene encodes the E3 binding protein subunit; also known as component X of the pyruvate dehydrogenase complex. This protein tethers E3 dimers to the E2 core of the PDH complex. Defects in this gene are a cause of pyruvate dehydrogenase deficiency which results in neurological dysfunction and lactic acidosis in infancy and early childhood. This protein is also a minor antigen for antimitochondrial antibodies. These autoantibodies are present in nearly 95% of patients with the autoimmune liver disease primary biliary cirrhosis (PBC). In PBC, activated T lymphocytes attack and destroy epithelial cells in the bile duct where this protein is abnormally distributed and overexpressed. PBC eventually leads to cirrhosis and liver failure. Alternative splicing results in multiple transcript variants encoding distinct isoforms.[provided by RefSeq, Oct 2009] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418661 | PDHX HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427526 | PDHX HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431233 | PDHX HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418661 | Transient overexpression lysate of pyruvate dehydrogenase complex, component X (PDHX), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CNY 3080.00 |
|
LY427526 | Transient overexpression lysate of pyruvate dehydrogenase complex, component X (PDHX), transcript variant 2 |
CNY 3080.00 |
|
LY431233 | Transient overexpression lysate of pyruvate dehydrogenase complex, component X (PDHX), nuclear gene encoding mitochondrial protein, transcript variant 3 |
CNY 3080.00 |
|
TP303138 | Recombinant protein of human pyruvate dehydrogenase complex, component X (PDHX), nuclear gene encoding mitochondrial protein, transcript variant 1, 20 µg |
CNY 2900.00 |