ATP6V1C1 (NM_001695) Human Mass Spec Standard
CAT#: PH303149
ATP6V1C1 MS Standard C13 and N15-labeled recombinant protein (NP_001686)
View other "ATP6V1C1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | ATP6V1C1 MS Standard C13 and N15-labeled recombinant protein (NP_001686) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203149 |
Predicted MW | 43.9 kDa |
Protein Sequence |
>RC203149 protein sequence
Red=Cloning site Green=Tags(s) MTEFWLISAPGEKTCQQTWEKLHAATSKNNNLAVTSKFNIPDLKVGTLDVLVGLSDELAKLDAFVEGVVK KVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLKNISEIIAKGVTQIDNDLKSRA SAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDSEYLVTLLVVVPKLNHNDWIKQYETLAEMVVP RSSNVLSEDQDSYLCNVTLFRKAVDDFRHKARENKFIVRDFQYNEEEMKADKEEMNRLSTDKKKQFGPLV RWLKVNFSEAFIAWIHVKALRVFVESVLRYGLPVNFQAMLLQPNKKTLKKLREVLHELYKHLDSSAAAII DAPMDIPGLNLSQQEYYPYVYYKIDCNLLEFK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001686 |
RefSeq Size | 5704 |
RefSeq ORF | 1146 |
Synonyms | ATP6C; ATP6D; VATC; Vma5 |
Locus ID | 528 |
Cytogenetics | 8q22.3 |
Summary | This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of intracellular compartments of eukaryotic cells. V-ATPase dependent acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c'', and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This gene is one of two genes that encode the V1 domain C subunit proteins and is found ubiquitously. This C subunit is analogous but not homologous to gamma subunit of F-ATPases. Previously, this gene was designated ATP6D. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Epithelial cell signaling in Helicobacter pylori infection, Metabolic pathways, Oxidative phosphorylation, Vibrio cholerae infection |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419795 | ATP6V1C1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419795 | Transient overexpression lysate of ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1 (ATP6V1C1) |
CNY 3080.00 |
|
TP303149 | Recombinant protein of human ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1 (ATP6V1C1), 20 µg |
CNY 2900.00 |
其它ATP6V1C1产品