Cyclophilin B (PPIB) (NM_000942) Human Mass Spec Standard
CAT#: PH303180
PPIB MS Standard C13 and N15-labeled recombinant protein (NP_000933)
View other "Cyclophilin B" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | PPIB MS Standard C13 and N15-labeled recombinant protein (NP_000933) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203180 |
| Predicted MW | 23.7 kDa |
| Protein Sequence |
>RC203180 protein sequence
Red=Cloning site Green=Tags(s) MLRLSERNMKVLLAAALIAGSVFFLLLPGPSAADEKKKGPKVTVKVYFDLRIGDEDVGRVIFGLFGKTVP KTVDNFVALATGEKGFGYKNSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGERFPDENFKLKHYGPGWVSM ANAGKDTNGSQFFITTVKTAWLDGKHVVFGKVLEGMEVVRKVESTKTDSRDKPLKDVIIADCGKIEVEKP FAIAKE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_000933 |
| RefSeq Size | 1045 |
| RefSeq ORF | 648 |
| Synonyms | B; CYP-S1; CYPB; HEL-S-39; OI9; SCYLP |
| Locus ID | 5479 |
| Cytogenetics | 15q22.31 |
| Summary | The protein encoded by this gene is a cyclosporine-binding protein and is mainly located within the endoplasmic reticulum. It is associated with the secretory pathway and released in biological fluids. This protein can bind to cells derived from T- and B-lymphocytes, and may regulate cyclosporine A-mediated immunosuppression. Variants have been identified in this protein that give rise to recessive forms of osteogenesis imperfecta. [provided by RefSeq, Oct 2009] |
| Protein Families | Druggable Genome, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC424437 | PPIB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY424437 | Transient overexpression lysate of peptidylprolyl isomerase B (cyclophilin B) (PPIB) |
CNY 3080.00 |
|
| TP303180 | Recombinant protein of human peptidylprolyl isomerase B (cyclophilin B) (PPIB), 20 µg |
CNY 2900.00 |
其它Cyclophilin B产品
