Phospholipase A2 IIA (PLA2G2A) (NM_000300) Human Mass Spec Standard
CAT#: PH303250
PLA2G2A MS Standard C13 and N15-labeled recombinant protein (NP_000291)
View other "Phospholipase A2 IIA" proteins (9)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | PLA2G2A MS Standard C13 and N15-labeled recombinant protein (NP_000291) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203250 |
| Predicted MW | 16.1 kDa |
| Protein Sequence |
>RC203250 protein sequence
Red=Cloning site Green=Tags(s) MKTLLLLAVIMIFGLLQAHGNLVNFHRMIKLTTGKEAALSYGFYGCHCGVGGRGSPKDATDRCCVTHDCC YKRLEKRGCGTKFLSYKFSNSGSRITCAKQDSCRSQLCECDKAAATCFARNKTTYNKKYQYYSNKHCRGS TPRC myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_000291 |
| RefSeq Size | 1017 |
| RefSeq ORF | 432 |
| Synonyms | MOM1; PLA2; PLA2B; PLA2L; PLA2S; PLAS1; sPLA2 |
| Locus ID | 5320 |
| Cytogenetics | 1p36.13 |
| Summary | The protein encoded by this gene is a member of the phospholipase A2 family (PLA2). PLA2s constitute a diverse family of enzymes with respect to sequence, function, localization, and divalent cation requirements. This gene product belongs to group II, which contains secreted form of PLA2, an extracellular enzyme that has a low molecular mass and requires calcium ions for catalysis. It catalyzes the hydrolysis of the sn-2 fatty acid acyl ester bond of phosphoglycerides, releasing free fatty acids and lysophospholipids, and thought to participate in the regulation of the phospholipid metabolism in biomembranes. Several alternatively spliced transcript variants with different 5' UTRs have been found for this gene.[provided by RefSeq, Sep 2009] |
| Protein Families | Druggable Genome, Transmembrane |
| Protein Pathways | alpha-Linolenic acid metabolism, Arachidonic acid metabolism, Ether lipid metabolism, Fc epsilon RI signaling pathway, Glycerophospholipid metabolism, GnRH signaling pathway, Linoleic acid metabolism, Long-term depression, MAPK signaling pathway, Metabolic pathways, Vascular smooth muscle contraction, VEGF signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC424814 | PLA2G2A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431765 | PLA2G2A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431766 | PLA2G2A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431767 | PLA2G2A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY424814 | Transient overexpression lysate of phospholipase A2, group IIA (platelets, synovial fluid) (PLA2G2A), transcript variant 1 |
CNY 3080.00 |
|
| LY431765 | Transient overexpression lysate of phospholipase A2, group IIA (platelets, synovial fluid) (PLA2G2A), transcript variant 2 |
CNY 3080.00 |
|
| LY431766 | Transient overexpression lysate of phospholipase A2, group IIA (platelets, synovial fluid) (PLA2G2A), transcript variant 3 |
CNY 3080.00 |
|
| LY431767 | Transient overexpression lysate of phospholipase A2, group IIA (platelets, synovial fluid) (PLA2G2A), transcript variant 4 |
CNY 3080.00 |
|
| TP303250 | Recombinant protein of human phospholipase A2, group IIA (platelets, synovial fluid) (PLA2G2A), 20 µg |
CNY 2900.00 |
其它Phospholipase A2 IIA产品
