Calprotectin (S100A8) (NM_002964) Human Mass Spec Standard
CAT#: PH303255
S100A8 MS Standard C13 and N15-labeled recombinant protein (NP_002955)
View other "S100A8" proteins (3)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
CNY 14250.00
Specifications
| Product Data | |
| Description | S100A8 MS Standard C13 and N15-labeled recombinant protein (NP_002955) | 
| Species | Human | 
| Expression Host | HEK293 | 
| Expression cDNA Clone or AA Sequence | RC203255 | 
| Predicted MW | 11.3 kDa | 
| Protein Sequence | 
                 >RC203255 representing NM_002964 
Red=Cloning site Green=Tags(s) MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQE FLILVIKMGVAAHKKSHEESHKE myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 | 
| Reference Data | |
| RefSeq | NP_002955 | 
| RefSeq Size | 532 | 
| RefSeq ORF | 279 | 
| Synonyms | 60B8AG; CAGA; CFAG; CGLA; CP-10; L1Ag; MA387; MIF; MRP8; NIF; P8 | 
| Locus ID | 6279 | 
| Cytogenetics | 1q21.3 | 
| Summary | The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and as a cytokine. Altered expression of this protein is associated with the disease cystic fibrosis. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2016] | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| TP303255 | Purified recombinant protein of Homo sapiens S100 calcium binding protein A8 (S100A8), 20 µg | 
                                                     
                                                        
                                                        
                                                        
                                                            CNY 2900.00  | 
                                            |
| TP750184 | Purified recombinant protein of Human S100 calcium binding protein A8 (S100A8), full length, with C-terminal His tag, expressed in E.coli, 50ug | 
                                                     CNY 2840.00  | 
                                            |
| TP750185 | Purified recombinant protein of Human Calprotectin antigen (S100A8/S100A9), full length, with C-His tag in the S100A8 and C-DDK Tag in the S100A9, expressed in E.coli, 50ug | 
                                                     CNY 2840.00  | 
                                            
