PEN2 (PSENEN) (NM_172341) Human Mass Spec Standard
CAT#: PH303272
PSENEN MS Standard C13 and N15-labeled recombinant protein (NP_758844)
View other "PEN2" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | PSENEN MS Standard C13 and N15-labeled recombinant protein (NP_758844) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203272 |
| Predicted MW | 12 kDa |
| Protein Sequence |
>RC203272 protein sequence
Red=Cloning site Green=Tags(s) MNLERVSNEEKLNLCRKYYLGGFAFLPFLWLVNIFWFFREAFLVPAYTEQSQIKGYVWRSAVGFLFWVIV LTSWITIFQIYRPRWGALGDYLSFTIPLGTP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_758844 |
| RefSeq Size | 834 |
| RefSeq ORF | 303 |
| Synonyms | ACNINV2; MDS033; MSTP064; PEN-2; PEN2 |
| Locus ID | 55851 |
| Cytogenetics | 19q13.12 |
| Summary | Presenilins, which are components of the gamma-secretase protein complex, are required for intramembranous processing of some type I transmembrane proteins, such as the Notch proteins and the beta-amyloid precursor protein. Signaling by Notch receptors mediates a wide range of developmental cell fates. Processing of the beta-amyloid precursor protein generates neurotoxic amyloid beta peptides, the major component of senile plaques associated with Alzheimer's disease. This gene encodes a protein that is required for Notch pathway signaling, and for the activity and accumulation of gamma-secretase. Mutations resulting in haploinsufficiency for this gene cause familial acne inversa-2 (ACNINV2). Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013] |
| Protein Families | Druggable Genome, Transmembrane |
| Protein Pathways | Alzheimer's disease, Notch signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403539 | PSENEN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403539 | Transient overexpression lysate of presenilin enhancer 2 homolog (C. elegans) (PSENEN) |
CNY 3080.00 |
|
| TP303272 | Recombinant protein of human presenilin enhancer 2 homolog (C. elegans) (PSENEN), 20 µg |
CNY 2900.00 |
