ATP6J (ATP6V1G1) (NM_004888) Human Mass Spec Standard
CAT#: PH303317
ATP6V1G1 MS Standard C13 and N15-labeled recombinant protein (NP_004879)
View other "ATP6J" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | ATP6V1G1 MS Standard C13 and N15-labeled recombinant protein (NP_004879) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203317 |
Predicted MW | 13.8 kDa |
Protein Sequence |
>RC203317 protein sequence
Red=Cloning site Green=Tags(s) MASQSQGIQQLLQAEKRAAEKVSEARKRKNRRLKQAKEEAQAEIEQYRLQREKEFKAKEAAALGSRGSCS TEVEKETQEKMTILQTYFRQNRDEVLDNLLAFVCDIRPEIHENYRING myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004879 |
RefSeq Size | 1611 |
RefSeq ORF | 354 |
Synonyms | ATP6G; ATP6G1; ATP6GL; ATP6J; Vma10 |
Locus ID | 9550 |
Cytogenetics | 9q32 |
Summary | This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A, three B, and two G subunits, as well as a C, D, E, F, and H subunit. The V1 domain contains the ATP catalytic site. The protein encoded by this gene is one of three V1 domain G subunit proteins. Pseudogenes of this gene have been characterized. [provided by RefSeq, Jul 2008] |
Protein Pathways | Epithelial cell signaling in Helicobacter pylori infection, Metabolic pathways, Oxidative phosphorylation, Vibrio cholerae infection |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417674 | ATP6V1G1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417674 | Transient overexpression lysate of ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G1 (ATP6V1G1) |
CNY 3080.00 |
|
TP303317 | Recombinant protein of human ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G1 (ATP6V1G1), 20 µg |
CNY 2900.00 |