BIN3 (NM_018688) Human Mass Spec Standard
CAT#: PH303378
BIN3 MS Standard C13 and N15-labeled recombinant protein (NP_061158)
View other "BIN3" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | BIN3 MS Standard C13 and N15-labeled recombinant protein (NP_061158) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203378 |
| Predicted MW | 29.7 kDa |
| Protein Sequence |
>RC203378 protein sequence
Red=Cloning site Green=Tags(s) MSWIPFKIGQPKKQIVPKTVERDFEREYGKLQQLEEQTRRLQKDMKKSTDADLAMSKSAVKISLDLLSNP LCEQDQDLLNMVTALDTAMKRMDAFNQEKVNQIQKTVIEPLKKFGSVFPSLNMAVKRREQALQDYRRLQA KVEKYEEKEKTGPVLAKLHQAREELRPVREDFEAKNRQLLEEMPRFYGSRLDYFQPSFESLIRAQVVYYS EMHKIFGDLSHQLDQPGHSDEQRERENEAKLSELRALSIVADD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_061158 |
| RefSeq Size | 1863 |
| RefSeq ORF | 759 |
| Locus ID | 55909 |
| Cytogenetics | 8p21.3 |
| Summary | The product of this gene is a member of the BAR domain protein family. The encoded protein is comprised solely of a BAR domain which is predicted to form coiled-coil structures and proposed to mediate dimerization, sense and induce membrane curvature, and bind small GTPases. BAR domain proteins have been implicated in endocytosis, intracellular transport, and a diverse set of other processes. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402705 | BIN3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402705 | Transient overexpression lysate of bridging integrator 3 (BIN3) |
CNY 3080.00 |
|
| TP303378 | Recombinant protein of human bridging integrator 3 (BIN3), 20 µg |
CNY 2900.00 |
