COPS4 (NM_016129) Human Mass Spec Standard
CAT#: PH303441
COPS4 MS Standard C13 and N15-labeled recombinant protein (NP_057213)
View other "COPS4" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | COPS4 MS Standard C13 and N15-labeled recombinant protein (NP_057213) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203441 |
| Predicted MW | 46.3 kDa |
| Protein Sequence |
>RC203441 protein sequence
Red=Cloning site Green=Tags(s) MAAAVRQDLAQLMNSSGSHKDLAGKYRQILEKAIQLSGAEQLEALKAFVEAMVNENVSLVISRQLLTDFC THLPNLPDSTAKEIYHFTLEKIQPRVISFEEQVASIRQHLASIYEKEEDWRNAAQVLVGIPLETGQKQYN VDYKLETYLKIARLYLEDDDPVQAEAYINRASLLQNESTNEQLQIHYKVCYARVLDYRRKFIEAAQRYNE LSYKTIVHESERLEALKHALHCTILASAGQQRSRMLATLFKDERCQQLAAYGILEKMYLDRIIRGNQLQE FAAMLMPHQKATTADGSSILDRAVIEHNLLSASKLYNNITFEELGALLEIPAAKAEKIASQMITEGRMNG FIDQIDGIVHFETREALPTWDKQIQSLCFQVNNLLEKISQTAPEWTAQAMEAQMAQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_057213 |
| RefSeq Size | 1765 |
| RefSeq ORF | 1218 |
| Synonyms | CSN4; SGN4 |
| Locus ID | 51138 |
| Cytogenetics | 4q21.22 |
| Summary | This gene encodes one of eight subunits composing COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Apr 2012] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402507 | COPS4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402507 | Transient overexpression lysate of COP9 constitutive photomorphogenic homolog subunit 4 (Arabidopsis) (COPS4) |
CNY 3080.00 |
|
| TP303441 | Recombinant protein of human COP9 constitutive photomorphogenic homolog subunit 4 (Arabidopsis) (COPS4), 20 µg |
CNY 2900.00 |
