Apg3 (ATG3) (NM_022488) Human Mass Spec Standard
CAT#: PH303453
ATG3 MS Standard C13 and N15-labeled recombinant protein (NP_071933)
View other "Apg3" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | ATG3 MS Standard C13 and N15-labeled recombinant protein (NP_071933) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203453 |
| Predicted MW | 35.9 kDa |
| Protein Sequence |
>RC203453 protein sequence
Red=Cloning site Green=Tags(s) MQNVINTVKGKALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHCPTWQWATGEELKVKAYLPTG KQFLVTKNVPCYKRCKQMEYSDELEAIIEEDDGDGGWVDTYHNTGITGITEAVKEITLENKDNIRLQDCS ALCEEEEDEDEGEAADMEEYEESGLLETDEATLDTRKIVEACKAKTDAGGEDAILQTRTYDLYITYDKYY QTPRLWLFGYDEQRQPLTVEHMYEDISQDHVKKTVTIENHPHLPPPPMCSVHPCRHAEVMKKIIETVAEG GGELGVHMYLLIFLKFVQAVIPTIEYDYTRHFTM myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_071933 |
| RefSeq Size | 1572 |
| RefSeq ORF | 942 |
| Synonyms | APG3; APG3-LIKE; APG3L; PC3-96 |
| Locus ID | 64422 |
| Cytogenetics | 3q13.2 |
| Summary | This gene encodes a ubiquitin-like-conjugating enzyme and is a component of ubiquitination-like systems involved in autophagy, the process of degradation, turnover and recycling of cytoplasmic constituents in eukaryotic cells. This protein is known to play a role in regulation of autophagy during cell death. A pseudogene of this gene is located on chromosome 20. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2013] |
| Protein Pathways | Regulation of autophagy |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411559 | ATG3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY411559 | Transient overexpression lysate of ATG3 autophagy related 3 homolog (S. cerevisiae) (ATG3) |
CNY 3080.00 |
|
| TP303453 | Recombinant protein of human ATG3 autophagy related 3 homolog (S. cerevisiae) (ATG3), 20 µg |
CNY 2900.00 |
|
| TP720530 | Recombinant protein of human ATG3 autophagy related 3 homolog (S. cerevisiae) (ATG3) |
CNY 1800.00 |
