VILIP3 (HPCAL1) (NM_134421) Human Mass Spec Standard
CAT#: PH303476
HPCAL1 MS Standard C13 and N15-labeled recombinant protein (NP_602293)
View other "VILIP3" proteins (8)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | HPCAL1 MS Standard C13 and N15-labeled recombinant protein (NP_602293) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203476 |
Predicted MW | 22.3 kDa |
Protein Sequence |
>RC203476 protein sequence
Red=Cloning site Green=Tags(s) MGKQNSKLRPEVLQDLRENTEFTDHELQEWYKGFLKDCPTGHLTVDEFKKIYANFFPYGDASKFAEHVFR TFDTNGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISRSEMLEIVQAIYKMVSSVMKMPE DESTPEKRTDKIFRQMDTNNDGKLSLEEFIRGAKSDPSIVRLLQCDPSSASQF myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_602293 |
RefSeq Size | 1921 |
RefSeq ORF | 579 |
Synonyms | BDR1; HLP2; VILIP-3 |
Locus ID | 3241 |
Cytogenetics | 2p25.1 |
Summary | The protein encoded by this gene is a member of neuron-specific calcium-binding proteins family found in the retina and brain. It is highly similar to human hippocalcin protein and nearly identical to the rat and mouse hippocalcin like-1 proteins. It may be involved in the calcium-dependent regulation of rhodopsin phosphorylation and may be of relevance for neuronal signalling in the central nervous system. Several alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Apr 2012] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408747 | HPCAL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC419502 | HPCAL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408747 | Transient overexpression lysate of hippocalcin-like 1 (HPCAL1), transcript variant 2 |
CNY 3080.00 |
|
LY419502 | Transient overexpression lysate of hippocalcin-like 1 (HPCAL1), transcript variant 1 |
CNY 3080.00 |
|
PH303570 | HPCAL1 MS Standard C13 and N15-labeled recombinant protein (NP_002140) |
CNY 19520.00 |
|
TP303476 | Recombinant protein of human hippocalcin-like 1 (HPCAL1), transcript variant 2, 20 µg |
CNY 2900.00 |
|
TP303570 | Recombinant protein of human hippocalcin-like 1 (HPCAL1), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP720206 | Recombinant protein of human hippocalcin-like 1 (HPCAL1), transcript variant 1 |
CNY 1800.00 |