CDC42EP1 (NM_007061) Human Mass Spec Standard
CAT#: PH303483
CDC42EP1 MS Standard C13 and N15-labeled recombinant protein (NP_008992)
View other "CDC42EP1" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | CDC42EP1 MS Standard C13 and N15-labeled recombinant protein (NP_008992) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203483 |
| Predicted MW | 39.7 kDa |
| Protein Sequence |
>RC203483 protein sequence
Red=Cloning site Green=Tags(s) MPGPQGGRGAATMSLGKLSPVGWVSSSQGKRRLTADMISHPLGDFRHTMHVGRGGDVFGDTSFLSNHGGS SGSTHRSPRSFLAKKLQLVRRVGAPPRRMASPPAPSPAPPAISPIIKNAISLPQLNQAAYDSLVVGKLSF DSSPTSSTDGHSSYGLDSGFCTISRLPRSEKPHDRDRDGSFPSEPGLRRSDSLLSFRLDLDLGPSLLSEL LGVMSLPEAPAAETPAPAANPPAPTANPTGPAANPPATTANPPAPAATPTGPAANPPAPAASSTPHGHCP NGVTAGLGPVAEVKSSPVGGGPRGPAGPALGRHWGAGWDGGHHYPEMDARQERVEVLPQARASWESLDEE WRAPQAGSRTPVPSTVQANTFEFADAEEDDEVKV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_008992 |
| RefSeq Size | 2182 |
| RefSeq ORF | 1152 |
| Synonyms | 55 kDa bone marrow stromal/endothelial cell protein; BORG5; CDC42 effector protein (Rho GTPase binding) 1; CDC42 effector protein 1; CEP1; CEP1, BORG5, MSE55, MGC15316; MGC15316; MSE55; OTTHUMP00000028709; serum constituent protein |
| Locus ID | 11135 |
| Cytogenetics | 22q13.1 |
| Summary | CDC42 is a member of the Rho GTPase family that regulates multiple cellular activities, including actin polymerization. The protein encoded by this gene is a CDC42 binding protein that mediates actin cytoskeleton reorganization at the plasma membrane. This protein is secreted and is primarily found in bone marrow. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC407674 | CDC42EP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC416226 | CDC42EP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY407674 | Transient overexpression lysate of CDC42 effector protein (Rho GTPase binding) 1 (CDC42EP1) |
CNY 3080.00 |
|
| LY416226 | Transient overexpression lysate of CDC42 effector protein (Rho GTPase binding) 1 (CDC42EP1), transcript variant 2 |
CNY 3080.00 |
|
| TP303483 | Recombinant protein of human CDC42 effector protein (Rho GTPase binding) 1 (CDC42EP1), transcript variant 2, 20 µg |
CNY 2900.00 |
其它CDC42EP1产品
