D4 (ARHGDIB) (NM_001175) Human Mass Spec Standard
CAT#: PH303496
ARHGDIB MS Standard C13 and N15-labeled recombinant protein (NP_001166)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | ARHGDIB MS Standard C13 and N15-labeled recombinant protein (NP_001166) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203496 |
Predicted MW | 23 kDa |
Protein Sequence |
>RC203496 protein sequence
Red=Cloning site Green=Tags(s) MTEKAPEPHVEEDDDDELDSKLNYKPPPQKSLKELQEMDKDDESLIKYKKTLLGDGPVVTDPKAPNVVVT RLTLVCESAPGPITMDLTGDLEALKKETIVLKEGSEYRVKIHFKVNRDIVSGLKYVQHTYRTGVKVDKAT FMVGSYGPRPEEYEFLTPVEEAPKGMLARGTYHNKSFFTDDDKQDHLSWEWNLSIKKEWTE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001166 |
RefSeq Size | 1216 |
RefSeq ORF | 603 |
Synonyms | D4; GDIA2; GDID4; Ly-GDI; LYGDI; RAP1GN1; RhoGDI2 |
Locus ID | 397 |
Cytogenetics | 12p12.3 |
Summary | Members of the Rho (or ARH) protein family (see MIM 165390) and other Ras-related small GTP-binding proteins (see MIM 179520) are involved in diverse cellular events, including cell signaling, proliferation, cytoskeletal organization, and secretion. The GTP-binding proteins are active only in the GTP-bound state. At least 3 classes of proteins tightly regulate cycling between the GTP-bound and GDP-bound states: GTPase-activating proteins (GAPs), guanine nucleotide-releasing factors (GRFs), and GDP-dissociation inhibitors (GDIs). The GDIs, including ARHGDIB, decrease the rate of GDP dissociation from Ras-like GTPases (summary by Scherle et al., 1993 [PubMed 8356058]).[supplied by OMIM, Dec 2010] |
Protein Families | Druggable Genome |
Protein Pathways | Neurotrophin signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400471 | ARHGDIB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400471 | Transient overexpression lysate of Rho GDP dissociation inhibitor (GDI) beta (ARHGDIB) |
CNY 3080.00 |
|
TP303496 | Recombinant protein of human Rho GDP dissociation inhibitor (GDI) beta (ARHGDIB), 20 µg |
CNY 2900.00 |