ABHD14B (NM_032750) Human Mass Spec Standard
CAT#: PH303520
ABHD14B MS Standard C13 and N15-labeled recombinant protein (NP_116139)
View other "ABHD14B" proteins (6)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | ABHD14B MS Standard C13 and N15-labeled recombinant protein (NP_116139) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203520 |
| Predicted MW | 22.3 kDa |
| Protein Sequence |
>RC203520 protein sequence
Red=Cloning site Green=Tags(s) MAASVEQREGTIQVQGQALFFREALPGSGQARFSVLLLHGIRFSSETWQNLGTLHRLAQAGYRAVAIDLP GLGHSKEAAAPAPIGELAPGSFLAAVVDALELGPPVVISPSLSGMYSLPFLTAPGSQLPGFVPVAPICTD KINAANYASVKTPALIVYGDQDPMGQTSFEHLKQLPNHRVLIMKGAGHPCYLDKPEEWHTGLLDFLQGLQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_116139 |
| RefSeq Size | 2447 |
| RefSeq ORF | 630 |
| Synonyms | CIB; HEL-S-299 |
| Locus ID | 84836 |
| Cytogenetics | 3p21.2 |
| Summary | Has hydrolase activity towards p-nitrophenyl butyrate (in vitro). May activate transcription.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409958 | ABHD14B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431791 | ABHD14B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY409958 | Transient overexpression lysate of abhydrolase domain containing 14B (ABHD14B), transcript variant 1 |
CNY 3080.00 |
|
| LY431791 | Transient overexpression lysate of abhydrolase domain containing 14B (ABHD14B), transcript variant 2 |
CNY 3080.00 |
|
| TP303520 | Recombinant protein of human abhydrolase domain containing 14B (ABHD14B), 20 µg |
CNY 2900.00 |
|
| TP328763 | Recombinant protein of human abhydrolase domain containing 14B (ABHD14B), transcript variant 2, 20 µg |
CNY 2900.00 |
其它ABHD14B产品
