RERG (NM_032918) Human Mass Spec Standard
CAT#: PH303564
RERG MS Standard C13 and N15-labeled recombinant protein (NP_116307)
View other "RERG" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | RERG MS Standard C13 and N15-labeled recombinant protein (NP_116307) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203564 |
| Predicted MW | 22.6 kDa |
| Protein Sequence |
>RC203564 protein sequence
Red=Cloning site Green=Tags(s) MAKSAEVKLAIFGRAGVGKSALVVRFLTKRFIWEYDPTLESTYRHQATIDDEVVSMEILDTAGQEDTIQR EGHMRWGEGFVLVYDITDRGSFEEVLPLKNILDEIKKPKNVTLILVGNKADLDHSRQVSTEEGEKLATEL ACAFYECSACTGEGNITEIFYELCREVRRRRMVQGKTRRRSSTTHVKQAINKMLTKISS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_116307 |
| RefSeq Size | 2325 |
| RefSeq ORF | 597 |
| Locus ID | 85004 |
| Cytogenetics | 12p12.3 |
| Summary | RERG, a member of the RAS superfamily of GTPases, inhibits cell proliferation and tumor formation (Finlin et al., 2001 [PubMed 11533059]).[supplied by OMIM, Mar 2009] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409869 | RERG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC434024 | RERG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY409869 | Transient overexpression lysate of RAS-like, estrogen-regulated, growth inhibitor (RERG) |
CNY 3080.00 |
|
| LY434024 | Transient overexpression lysate of RAS-like, estrogen-regulated, growth inhibitor (RERG), transcript variant 2 |
CNY 3080.00 |
|
| TP303564 | Recombinant protein of human RAS-like, estrogen-regulated, growth inhibitor (RERG), 20 µg |
CNY 2900.00 |
