ARF6 (NM_001663) Human Mass Spec Standard
CAT#: PH303600
ARF6 MS Standard C13 and N15-labeled recombinant protein (NP_001654)
View other "ARF6" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | ARF6 MS Standard C13 and N15-labeled recombinant protein (NP_001654) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203600 |
| Predicted MW | 20.1 kDa |
| Protein Sequence |
>RC203600 protein sequence
Red=Cloning site Green=Tags(s) MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKI RPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLG LTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001654 |
| RefSeq Size | 3939 |
| RefSeq ORF | 525 |
| Locus ID | 382 |
| Cytogenetics | 14q21.3 |
| Summary | This gene encodes a member of the human ARF gene family, which is part of the RAS superfamily. The ARF genes encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as activators of phospholipase D. The product of this gene is localized to the plasma membrane, and regulates vesicular trafficking, remodelling of membrane lipids, and signaling pathways that lead to actin remodeling. A pseudogene of this gene is located on chromosome 7. [provided by RefSeq, Jul 2008] |
| Protein Pathways | Endocytosis, Fc gamma R-mediated phagocytosis |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400629 | ARF6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400629 | Transient overexpression lysate of ADP-ribosylation factor 6 (ARF6) |
CNY 3080.00 |
|
| TP303600 | Recombinant protein of human ADP-ribosylation factor 6 (ARF6), 20 µg |
CNY 2900.00 |
