PDRG1 (NM_030815) Human Mass Spec Standard
CAT#: PH303661
PDRG1 MS Standard C13 and N15-labeled recombinant protein (NP_110442)
View other "PDRG1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | PDRG1 MS Standard C13 and N15-labeled recombinant protein (NP_110442) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203661 |
| Predicted MW | 15.5 kDa |
| Protein Sequence |
>RC203661 protein sequence
Red=Cloning site Green=Tags(s) MLSPEAERVLRYLVEVEELAEEVLADKRQIVDLDTKRNQNREGLRALQKDLSLSEDVMVCFGNMFIKMPH PETKEMIEKDQDHLDKEIEKLRKQLKVKVNRLFEAQGKPELKGFNLNPLNQDELKALKVILKG myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_110442 |
| RefSeq Size | 1384 |
| RefSeq ORF | 399 |
| Synonyms | C20orf126; PDRG |
| Locus ID | 81572 |
| Cytogenetics | 20q11.21 |
| Summary | May play a role in chaperone-mediated protein folding.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC410685 | PDRG1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY410685 | Transient overexpression lysate of p53 and DNA-damage regulated 1 (PDRG1) |
CNY 3080.00 |
|
| TP303661 | Recombinant protein of human p53 and DNA damage regulated 1 (PDRG1), 20 µg |
CNY 2900.00 |
