VSIG4 (NM_007268) Human Mass Spec Standard
CAT#: PH303751
VSIG4 MS Standard C13 and N15-labeled recombinant protein (NP_009199)
View other "VSIG4" proteins (6)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | VSIG4 MS Standard C13 and N15-labeled recombinant protein (NP_009199) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203751 |
| Predicted MW | 44 kDa |
| Protein Sequence |
>RC203751 protein sequence
Red=Cloning site Green=Tags(s) MGILLGLLLLGHLTVDTYGRPILEVPESVTGPWKGDVNLPCTYDPLQGYTQVLVKWLVQRGSDPVTIFLR DSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSV SKPTVTTGSGYGFTVPQGMRISLQCQARGSPPISYIWYKQQTNNQEPIKVATLSTLLFKPAVIADSGSYF CTAKGQVGSEQHSDIVKFVVKDSSKLLKTKTEAPTTMTYPLKATSTVKQSWDWTTDMDGYLGETSAGPGK SLPVFAIILIISLCCMVVFTMAYIMLCRKTSQQEHVYEAARAHAREANDSGETMRVAIFASGCSSDEPTS QNLGNNYSDEPCIGQEYQIIAQINGNYARLLDTVPLDYEFLATEGKSVC myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_009199 |
| RefSeq Size | 1869 |
| RefSeq ORF | 1197 |
| Synonyms | CRIg; Z39IG |
| Locus ID | 11326 |
| Cytogenetics | Xq12 |
| Summary | This gene encodes a v-set and immunoglobulin-domain containing protein that is structurally related to the B7 family of immune regulatory proteins. The encoded protein may be a negative regulator of T-cell responses. This protein is also a receptor for the complement component 3 fragments C3b and iC3b. Alternate splicing results in multiple transcript variants. [provided by RefSeq, May 2010] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416087 | VSIG4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420270 | VSIG4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY416087 | Transient overexpression lysate of V-set and immunoglobulin domain containing 4 (VSIG4), transcript variant 1 |
CNY 3080.00 |
|
| LY420270 | Transient overexpression lysate of V-set and immunoglobulin domain containing 4 (VSIG4), transcript variant 2 |
CNY 3080.00 |
|
| TP303751 | Recombinant protein of human V-set and immunoglobulin domain containing 4 (VSIG4), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP720454 | Recombinant protein of human V-set and immunoglobulin domain containing 4 (VSIG4), transcript variant 2 |
CNY 1800.00 |
