ROC2 (RNF7) (NM_014245) Human Mass Spec Standard
CAT#: PH303831
RNF7 MS Standard C13 and N15-labeled recombinant protein (NP_055060)
View other "ROC2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | RNF7 MS Standard C13 and N15-labeled recombinant protein (NP_055060) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203831 |
Predicted MW | 12.7 kDa |
Protein Sequence |
>RC203831 protein sequence
Red=Cloning site Green=Tags(s) MADVEDGEETCALASHSGSSGSKSGGDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQAENKQ EDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_055060 |
RefSeq Size | 2010 |
RefSeq ORF | 339 |
Synonyms | CKBBP1; rbx2; ROC2; SAG |
Locus ID | 9616 |
Cytogenetics | 3q23 |
Summary | The protein encoded by this gene is a highly conserved ring finger protein. It is an essential subunit of SKP1-cullin/CDC53-F box protein ubiquitin ligases, which are a part of the protein degradation machinery important for cell cycle progression and signal transduction. This protein interacts with, and is a substrate of, casein kinase II (CSNK2A1/CKII). The phosphorylation of this protein by CSNK2A1 has been shown to promote the degradation of IkappaBalpha (CHUK/IKK-alpha/IKBKA) and p27Kip1(CDKN1B). Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Ubiquitin mediated proteolysis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402297 | RNF7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402297 | Transient overexpression lysate of ring finger protein 7 (RNF7), transcript variant 1 |
CNY 3080.00 |
|
TP303831 | Recombinant protein of human ring finger protein 7 (RNF7), transcript variant 1, 20 µg |
CNY 2900.00 |