PSMG3 (NM_032302) Human Mass Spec Standard
CAT#: PH303835
PSMG3 MS Standard C13 and N15-labeled recombinant protein (NP_115678)
View other "PSMG3" proteins (6)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | PSMG3 MS Standard C13 and N15-labeled recombinant protein (NP_115678) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203835 |
Predicted MW | 13.1 kDa |
Protein Sequence |
>RC203835 protein sequence
Red=Cloning site Green=Tags(s) MEDTPLVISKQKTEVVCGVPTQVVCTAFSSHILVVVTQFGKMGTLVSLEPSSVASDVSKPVLTTKVLLGQ DEPLIHVFAKNLVAFVSQEAGNRAVLLAVAVKDKSMEGLKALREVIRVCQVW myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_115678 |
RefSeq Size | 1395 |
RefSeq ORF | 366 |
Synonyms | C7orf48; PAC3 |
Locus ID | 84262 |
Cytogenetics | 7p22.3 |
Summary | Chaperone protein which promotes assembly of the 20S proteasome. May cooperate with PSMG1-PSMG2 heterodimers to orchestrate the correct assembly of proteasomes.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410244 | PSMG3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427395 | PSMG3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410244 | Transient overexpression lysate of proteasome (prosome, macropain) assembly chaperone 3 (PSMG3), transcript variant 1 |
CNY 3080.00 |
|
LY427395 | Transient overexpression lysate of proteasome (prosome, macropain) assembly chaperone 3 (PSMG3), transcript variant 2 |
CNY 3080.00 |
|
TP303835 | Recombinant protein of human proteasome (prosome, macropain) assembly chaperone 3 (PSMG3), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP760843 | Purified recombinant protein of Human proteasome (prosome, macropain) assembly chaperone 3 (PSMG3), full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2040.00 |