PSMG3 (NM_032302) Human Mass Spec Standard
CAT#: PH303835
PSMG3 MS Standard C13 and N15-labeled recombinant protein (NP_115678)
View other "PSMG3" proteins (6)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | PSMG3 MS Standard C13 and N15-labeled recombinant protein (NP_115678) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203835 |
| Predicted MW | 13.1 kDa |
| Protein Sequence |
>RC203835 protein sequence
Red=Cloning site Green=Tags(s) MEDTPLVISKQKTEVVCGVPTQVVCTAFSSHILVVVTQFGKMGTLVSLEPSSVASDVSKPVLTTKVLLGQ DEPLIHVFAKNLVAFVSQEAGNRAVLLAVAVKDKSMEGLKALREVIRVCQVW myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_115678 |
| RefSeq Size | 1395 |
| RefSeq ORF | 366 |
| Synonyms | C7orf48; PAC3 |
| Locus ID | 84262 |
| Cytogenetics | 7p22.3 |
| Summary | Chaperone protein which promotes assembly of the 20S proteasome. May cooperate with PSMG1-PSMG2 heterodimers to orchestrate the correct assembly of proteasomes.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC410244 | PSMG3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427395 | PSMG3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY410244 | Transient overexpression lysate of proteasome (prosome, macropain) assembly chaperone 3 (PSMG3), transcript variant 1 |
CNY 3080.00 |
|
| LY427395 | Transient overexpression lysate of proteasome (prosome, macropain) assembly chaperone 3 (PSMG3), transcript variant 2 |
CNY 3080.00 |
|
| TP303835 | Recombinant protein of human proteasome (prosome, macropain) assembly chaperone 3 (PSMG3), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP760843 | Purified recombinant protein of Human proteasome (prosome, macropain) assembly chaperone 3 (PSMG3), full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2040.00 |
