ERO1L (ERO1A) (NM_014584) Human Mass Spec Standard
CAT#: PH303840
ERO1L MS Standard C13 and N15-labeled recombinant protein (NP_055399)
View other "ERO1L" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | ERO1L MS Standard C13 and N15-labeled recombinant protein (NP_055399) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203840 |
| Predicted MW | 54.4 kDa |
| Protein Sequence |
>RC203840 protein sequence
Red=Cloning site Green=Tags(s) MGRGWGFLFGLLGAVWLLSSGHGEEQPPETAAQRCFCQVSGYLDDCTCDVETIDRFNNYRLFPRLQKLLE SDYFRYYKVNLKRPCPFWNDISQCGRRDCAVKPCQSDEVPDGIKSASYKYSEEANNLIEECEQAERLGAV DESLSEETQKAVLQWTKHDDSSDNFCEADDIQSPEAEYVDLLLNPERYTGYKGPDAWKIWNVIYEENCFK PQTIKRPLNPLASGQGTSEENTFYSWLEGLCVEKRAFYRLISGLHASINVHLSARYLLQETWLEKKWGHN ITEFQQRFDGILTEGEGPRRLKNLYFLYLIELRALSKVLPFFERPDFQLFTGNKIQDEENKMLLLEILHE IKSFPLHFDENSFFAGDKKEAHKLKEDFRLHFRNISRIMDCVGCFKCRLWGKLQTQGLGTALKILFSEKL IANMPESGPSYEFHLTRQEIVSLFNAFGRISTSVKELENFRNLLQNIH myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_055399 |
| RefSeq Size | 3334 |
| RefSeq ORF | 1404 |
| Synonyms | ERO1-alpha; ERO1-L; ERO1-L-alpha; Ero1alpha; ERO1L; ERO1LA |
| Locus ID | 30001 |
| Cytogenetics | 14q22.1 |
| Summary | Oxidoreductase involved in disulfide bond formation in the endoplasmic reticulum. Efficiently reoxidizes P4HB/PDI, the enzyme catalyzing protein disulfide formation, in order to allow P4HB to sustain additional rounds of disulfide formation. Following P4HB reoxidation, passes its electrons to molecular oxygen via FAD, leading to the production of reactive oxygen species (ROS) in the cell. Required for the proper folding of immunoglobulins. Involved in the release of the unfolded cholera toxin from reduced P4HB/PDI in case of infection by V.cholerae, thereby playing a role in retrotranslocation of the toxin. Plays an important role in ER stress-induced, CHOP-dependent apoptosis by activating the inositol 1,4,5-trisphosphate receptor IP3R1.[UniProtKB/Swiss-Prot Function] |
| Protein Pathways | Vibrio cholerae infection |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC415183 | ERO1L HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY415183 | Transient overexpression lysate of ERO1-like (S. cerevisiae) (ERO1L) |
CNY 3080.00 |
|
| TP303840 | Recombinant protein of human ERO1-like (S. cerevisiae) (ERO1L), 20 µg |
CNY 2900.00 |
