Adiponectin Receptor 1 (ADIPOR1) (NM_015999) Human Mass Spec Standard
CAT#: PH303907
ADIPOR1 MS Standard C13 and N15-labeled recombinant protein (NP_057083)
View other "Adiponectin Receptor 1" proteins (5)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
CNY 19520.00
Specifications
| Product Data | |
| Description | ADIPOR1 MS Standard C13 and N15-labeled recombinant protein (NP_057083) | 
| Species | Human | 
| Expression Host | HEK293 | 
| Expression cDNA Clone or AA Sequence | RC203907 | 
| Predicted MW | 42.6 kDa | 
| Protein Sequence | 
                 >RC203907 protein sequence 
Red=Cloning site Green=Tags(s) MSSHKGSVVAQGNGAPASNREADTVELAELGPLLEEKGKRVIANPPKAEEEQTCPVPQEEEEEVRVLTLP LQAHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWT HLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYS GIALLIMGSFVPWLYYSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVV PTMHFTIAEGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFV HFYGVSNLQEFRYGLEGGCTDDTLL myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 | 
| Reference Data | |
| RefSeq | NP_057083 | 
| RefSeq Size | 2184 | 
| RefSeq ORF | 1125 | 
| Synonyms | ACDCR1; CGI-45; CGI45; PAQR1; TESBP1A | 
| Locus ID | 51094 | 
| Cytogenetics | 1q32.1 | 
| Summary | This gene encodes a protein which acts as a receptor for adiponectin, a hormone secreted by adipocytes which regulates fatty acid catabolism and glucose levels. Binding of adiponectin to the encoded protein results in activation of an AMP-activated kinase signaling pathway which affects levels of fatty acid oxidation and insulin sensitivity. A pseudogene of this gene is located on chromosome 14. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Mar 2014] | 
| Protein Families | Druggable Genome, Transmembrane | 
| Protein Pathways | Adipocytokine signaling pathway | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC402486 | ADIPOR1 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LC426849 | ADIPOR1 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY402486 | Transient overexpression lysate of adiponectin receptor 1 (ADIPOR1), transcript variant 1 | 
                                                     CNY 3080.00  | 
                                            |
| LY426849 | Transient overexpression lysate of adiponectin receptor 1 (ADIPOR1), transcript variant 2 | 
                                                     CNY 3080.00  | 
                                            |
| TP303907 | Recombinant protein of human adiponectin receptor 1 (ADIPOR1), transcript variant 1, 20 µg | 
                                                     
                                                        
                                                        
                                                        
                                                            CNY 2900.00  | 
                                            
其它Adiponectin Receptor 1产品
