LITAF (NM_004862) Human Mass Spec Standard
CAT#: PH303938
LITAF MS Standard C13 and N15-labeled recombinant protein (NP_004853)
View other "LITAF" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | LITAF MS Standard C13 and N15-labeled recombinant protein (NP_004853) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203938 |
Predicted MW | 17.1 kDa |
Protein Sequence |
>RC203938 protein sequence
Red=Cloning site Green=Tags(s) MSVPGPYQAATGPSSAPSAPPSYEETVAVNSYYPTPPAPMPGPTTGLVTGPDGKGMNPPSYYTQPAPIPN NNPITVQTVYVQHPITFLDRPIQMCCPSCNKMIVSQLSYNAGALTWLSCGSLCLLGCIAGCCFIPFCVDA LQDVDHYCPNCRALLGTYKRL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004853 |
RefSeq Size | 2642 |
RefSeq ORF | 483 |
Synonyms | PIG7; SIMPLE; TP53I7 |
Locus ID | 9516 |
Cytogenetics | 16p13.13 |
Summary | Lipopolysaccharide is a potent stimulator of monocytes and macrophages, causing secretion of tumor necrosis factor-alpha (TNF-alpha) and other inflammatory mediators. This gene encodes lipopolysaccharide-induced TNF-alpha factor, which is a DNA-binding protein and can mediate the TNF-alpha expression by direct binding to the promoter region of the TNF-alpha gene. The transcription of this gene is induced by tumor suppressor p53 and has been implicated in the p53-induced apoptotic pathway. Mutations in this gene cause Charcot-Marie-Tooth disease type 1C (CMT1C) and may be involved in the carcinogenesis of extramammary Paget's disease (EMPD). Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Dec 2014] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417698 | LITAF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427883 | LITAF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427884 | LITAF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417698 | Transient overexpression lysate of lipopolysaccharide-induced TNF factor (LITAF), transcript variant 1 |
CNY 3080.00 |
|
LY427883 | Transient overexpression lysate of lipopolysaccharide-induced TNF factor (LITAF), transcript variant 2 |
CNY 3080.00 |
|
LY427884 | Transient overexpression lysate of lipopolysaccharide-induced TNF factor (LITAF), transcript variant 3 |
CNY 3080.00 |
|
TP303938 | Recombinant protein of human lipopolysaccharide-induced TNF factor (LITAF), transcript variant 1, 20 µg |
CNY 2900.00 |