MAX (NM_145114) Human Mass Spec Standard
CAT#: PH303944
MAX MS Standard C13 and N15-labeled recombinant protein (NP_660089)
View other "MAX" proteins (17)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | MAX MS Standard C13 and N15-labeled recombinant protein (NP_660089) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203944 |
| Predicted MW | 11.5 kDa |
| Protein Sequence |
>RC203944 protein sequence
Red=Cloning site Green=Tags(s) MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKLYFLFWKLCTPVL HRQSLMQKCHTFISSYQVHKKKECKI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_660089 |
| RefSeq Size | 937 |
| RefSeq ORF | 288 |
| Synonyms | bHLHd4 |
| Locus ID | 4149 |
| Cytogenetics | 14q23.3 |
| Summary | The protein encoded by this gene is a member of the basic helix-loop-helix leucine zipper (bHLHZ) family of transcription factors. It is able to form homodimers and heterodimers with other family members, which include Mad, Mxi1 and Myc. Myc is an oncoprotein implicated in cell proliferation, differentiation and apoptosis. The homodimers and heterodimers compete for a common DNA target site (the E box) and rearrangement among these dimer forms provides a complex system of transcriptional regulation. Mutations of this gene have been reported to be associated with hereditary pheochromocytoma. A pseudogene of this gene is located on the long arm of chromosome 7. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2012] |
| Protein Families | Druggable Genome, Transcription Factors |
| Protein Pathways | MAPK signaling pathway, Pathways in cancer, Small cell lung cancer |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408018 | MAX HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC408019 | MAX HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC408020 | MAX HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC408022 | MAX HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY408018 | Transient overexpression lysate of MYC associated factor X (MAX), transcript variant 2 |
CNY 3080.00 |
|
| LY408019 | Transient overexpression lysate of MYC associated factor X (MAX), transcript variant 3 |
CNY 3080.00 |
|
| LY408020 | Transient overexpression lysate of MYC associated factor X (MAX), transcript variant 4 |
CNY 3080.00 |
|
| LY408022 | Transient overexpression lysate of MYC associated factor X (MAX), transcript variant 5 |
CNY 3080.00 |
|
| PH306294 | MAX MS Standard C13 and N15-labeled recombinant protein (NP_660092) |
CNY 19520.00 |
|
| PH306812 | MAX MS Standard C13 and N15-labeled recombinant protein (NP_660087) |
CNY 19520.00 |
|
| PH320343 | MAX MS Standard C13 and N15-labeled recombinant protein (NP_660088) |
CNY 19520.00 |
|
| TP303944 | Recombinant protein of human MYC associated factor X (MAX), transcript variant 4, 20 µg |
CNY 2900.00 |
|
| TP306294 | Recombinant protein of human MYC associated factor X (MAX), transcript variant 5, 20 µg |
CNY 2900.00 |
|
| TP306812 | Recombinant protein of human MYC associated factor X (MAX), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP320343 | Recombinant protein of human MYC associated factor X (MAX), transcript variant 3, 20 µg |
CNY 2900.00 |
|
| TP720173 | Recombinant protein of human MYC associated factor X (MAX), transcript variant 1 |
CNY 1800.00 |
|
| TP761118 | Purified recombinant protein of Human MYC associated factor X (MAX), transcript variant 1, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2040.00 |
