GIMAP5 (NM_018384) Human Mass Spec Standard
CAT#: PH303978
GIMAP5 MS Standard C13 and N15-labeled recombinant protein (NP_060854)
View other "GIMAP5" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | GIMAP5 MS Standard C13 and N15-labeled recombinant protein (NP_060854) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203978 |
| Predicted MW | 34.8 kDa |
| Protein Sequence |
>RC203978 protein sequence
Red=Cloning site Green=Tags(s) MGGFQRGKYGTMAEGRSEDNLSATPPALRIILVGKTGCGKSATGNSILGQPVFESKLRAQSVTRTCQVKT GTWNGRKVLVVDTPSIFESQADTQELYKNIGDCYLLSAPGPHVLLLVIQLGRFTAQDTVAIRKVKEVFGT GAMRHVVILFTHKEDLGGQALDDYVANTDNCSLKDLVRECERRYCAFNNWGSVEEQRQQQAELLAVIERL GREREGSFHSNDLFLDAQLLQRTGAGACQEDYRQYQAKVEWQVEKHKQELRENESNWAYKALLRVKHLML LHYEIFVFLLLCSILFFIIFLFIFHYI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_060854 |
| RefSeq Size | 1895 |
| RefSeq ORF | 921 |
| Synonyms | HIMAP3; IAN-5; IAN4; IAN4L1; IAN5; IMAP3; IROD |
| Locus ID | 55340 |
| Cytogenetics | 7q36.1 |
| Summary | This gene encodes a protein belonging to the GTP-binding superfamily and to the immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins. In humans, the IAN subfamily genes are located in a cluster at 7q36.1. This gene encodes an antiapoptotic protein that functions in T-cell survival. Polymorphisms in this gene are associated with systemic lupus erythematosus. Read-through transcription exists between this gene and the neighboring upstream GIMAP1 (GTPase, IMAP family member 1) gene. [provided by RefSeq, Dec 2010] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC413083 | GIMAP5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY413083 | Transient overexpression lysate of GTPase, IMAP family member 5 (GIMAP5) |
CNY 3080.00 |
|
| TP303978 | Recombinant protein of human GTPase, IMAP family member 5 (GIMAP5), 20 µg |
CNY 2900.00 |
