FHL3 (NM_004468) Human Mass Spec Standard
CAT#: PH303991
FHL3 MS Standard C13 and N15-labeled recombinant protein (NP_004459)
View other "FHL3" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | FHL3 MS Standard C13 and N15-labeled recombinant protein (NP_004459) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203991 |
| Predicted MW | 31.2 kDa |
| Protein Sequence |
>RC203991 protein sequence
Red=Cloning site Green=Tags(s) MSESFDCAKCNESLYGRKYIQTDSGPYCVPCYDNTFANTCAECQQLIGHDSRELFYEDRHFHEGCFRCCR CQRSLADEPFTCQDSELLCNDCYCSAFSSQCSACGETVMPGSRKLEYGGQTWHEHCFLCSGCEQPLGSRS FVPDKGAHYCVPCYENKFAPRCARCSKTLTQGGVTYRDQPWHRECLVCTGCQTPLAGQQFTSRDEDPYCV ACFGELFAPKCSSCKRPIVGLGGGKYVSFEDRHWHHNCFSCARCSTSLVGQGFVPDGDQVLCQGCSQAGP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_004459 |
| RefSeq Size | 1662 |
| RefSeq ORF | 840 |
| Synonyms | SLIM2 |
| Locus ID | 2275 |
| Cytogenetics | 1p34.3 |
| Summary | The protein encoded by this gene is a member of a family of proteins containing a four-and-a-half LIM domain, which is a highly conserved double zinc finger motif. The encoded protein has been shown to interact with the cancer developmental regulators SMAD2, SMAD3, and SMAD4, the skeletal muscle myogenesis protein MyoD, and the high-affinity IgE beta chain regulator MZF-1. This protein may be involved in tumor suppression, repression of MyoD expression, and repression of IgE receptor expression. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2011] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417968 | FHL3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY417968 | Transient overexpression lysate of four and a half LIM domains 3 (FHL3) |
CNY 3080.00 |
|
| TP303991 | Recombinant protein of human four and a half LIM domains 3 (FHL3), 20 µg |
CNY 2900.00 |
