PERP (NM_022121) Human Mass Spec Standard
CAT#: PH304012
PERP MS Standard C13 and N15-labeled recombinant protein (NP_071404)
View other "PERP" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Cited in 1 publication. |
Specifications
Product Data | |
Description | PERP MS Standard C13 and N15-labeled recombinant protein (NP_071404) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204012 |
Predicted MW | 21.4 kDa |
Protein Sequence |
>RC204012 protein sequence
Red=Cloning site Green=Tags(s) MIRCGLACERCRWILPLLLLSAIAFDIIALAGRGWLQSSDHGQTSSLWWKCSQEGGGSGSYEEGCQSLME YAWGRAAAAMLFCGFIILVICFILSFFALCGPQMLVFLRVIGGLLALAAVFQIISLVIYPVKYTQTFTLH ANPAVTYIYNWAYGFGWAATIILIGCAFFFCCLPNYEDDLLGNAKPRYFYTSA SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_071404 |
RefSeq Size | 4319 |
RefSeq ORF | 579 |
Synonyms | dJ496H19.1; KCP1; KRTCAP1; PIGPC1; THW |
Locus ID | 64065 |
Cytogenetics | 6q23.3 |
Summary | Component of intercellular desmosome junctions. Plays a role in stratified epithelial integrity and cell-cell adhesion by promoting desmosome assembly. Plays a role as an effector in the TP53-dependent apoptotic pathway (By similarity).[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | p53 signaling pathway |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
ALCAM is indirectly modulated by miR-125b in MCF7 cells.
,null,
Tumour biology : the journal of the International Society for Oncodevelopmental Biology and Medicine
,PubMed ID 25539763
[PERP]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411759 | PERP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411759 | Transient overexpression lysate of PERP, TP53 apoptosis effector (PERP) |
CNY 3080.00 |
|
TP304012 | Recombinant protein of human PERP, TP53 apoptosis effector (PERP), 20 µg |
CNY 2900.00 |