Ubiquilin (UBQLN1) (NM_053067) Human Mass Spec Standard
CAT#: PH304020
UBQLN1 MS Standard C13 and N15-labeled recombinant protein (NP_444295)
View other "Ubiquilin" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
| Cited in 1 publication. |
Specifications
| Product Data | |
| Description | UBQLN1 MS Standard C13 and N15-labeled recombinant protein (NP_444295) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204020 |
| Predicted MW | 59.2 kDa |
| Protein Sequence |
>RC204020 protein sequence
Red=Cloning site Green=Tags(s) MAESGESGGPPGSQDSAAGAEGAGAPAAAASAEPKIMKVTVKTPKEKEEFAVPENSSVQQFKEEISKRFK SHTDQLVLIFAGKILKDQDTLSQHGIHDGLTVHLVIKTQNRPQDHSAQQTNTAGSNVTTSSTPNSNSTSG SATSNPFGLGGLGGLAGLSSLGLNTTNFSELQSQMQRQLLSNPEMMVQIMENPFVQSMLSNPDLMRQLIM ANPQMQQLIQRNPEISHMLNNPDIMRQTLELARNPAMMQEMMRNQDRALSNLESIPGGYNALRRMYTDIQ EPMLSAAQEQFGGNPFASLVSNTSSGEGSQPSRTENRDPLPNPWAPQTSQSSSASSGTASTVGGTTGSTA SGTSGQSTTAPNLVPGVGASMFNTPGMQSLLQQITENPQLMQNMLSAPYMRSMMQSLSQNPDLAAQMQNP DTLSAMSNPRAMQALLQIQQGLQTLATEAPGLIPGFTPGLGALGSTGGSSGTNGSNATPSENTSPTAGTT EPGHQQFIQQMLQALAGVNPQLQNPEVRFQQQLEQLSAMGFLNREANLQALIATGGDINAAIERLLGSQP S myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_444295 |
| RefSeq Size | 4093 |
| RefSeq ORF | 1683 |
| Synonyms | DA41; DSK2; PLIC-1; UBQN; XDRP1 |
| Locus ID | 29979 |
| Cytogenetics | 9q21.2-q21.3 |
| Summary | This gene encodes an ubiquitin-like protein (ubiquilin) that shares a high degree of similarity with related products in yeast, rat and frog. Ubiquilins contain an N-terminal ubiquitin-like domain and a C-terminal ubiquitin-associated domain. They physically associate with both proteasomes and ubiquitin ligases, and thus are thought to functionally link the ubiquitination machinery to the proteasome to affect in vivo protein degradation. This ubiquilin has also been shown to modulate accumulation of presenilin proteins, and it is found in lesions associated with Alzheimer's and Parkinson's disease. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
The TREX1 C-terminal Region Controls Cellular Localization through Ubiquitination *
,null,
The Journal of Biological Chemistry
,PubMed ID 23979357
[UBQLN1]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402265 | UBQLN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC409314 | UBQLN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402265 | Transient overexpression lysate of ubiquilin 1 (UBQLN1), transcript variant 1 |
CNY 3080.00 |
|
| LY409314 | Transient overexpression lysate of ubiquilin 1 (UBQLN1), transcript variant 2 |
CNY 3080.00 |
|
| PH306897 | UBQLN1 MS Standard C13 and N15-labeled recombinant protein (NP_038466) |
CNY 19520.00 |
|
| TP304020 | Recombinant protein of human ubiquilin 1 (UBQLN1), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP306897 | Recombinant protein of human ubiquilin 1 (UBQLN1), transcript variant 1, 20 µg |
CNY 2900.00 |
其它Ubiquilin产品
