NC2 alpha (DRAP1) (NM_006442) Human Mass Spec Standard
CAT#: PH304031
DRAP1 MS Standard C13 and N15-labeled recombinant protein (NP_006433)
View other "NC2 alpha" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | DRAP1 MS Standard C13 and N15-labeled recombinant protein (NP_006433) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204031 |
Predicted MW | 22.3 kDa |
Protein Sequence |
>RC204031 protein sequence
Red=Cloning site Green=Tags(s) MPSKKKKYNARFPPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSRNAKTMTTSHL KQCIELEQQFDFLKDLVASVPDMQGDGEDNHMDGDKGARRGRKPGSGGRKNGGMGTKSKDKKLSGTDSEQ EDESEDTDTDGEEETSQPPPQASHPSAHFQSPPTPFLPFASTLPLPPAPPGPSAPDEEDEEDYDS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_006433 |
RefSeq Size | 1022 |
RefSeq ORF | 615 |
Synonyms | NC2-alpha |
Locus ID | 10589 |
Cytogenetics | 11q13.1 |
Summary | Transcriptional repression is a general mechanism for regulating transcriptional initiation in organisms ranging from yeast to humans. Accurate initiation of transcription from eukaryotic protein-encoding genes requires the assembly of a large multiprotein complex consisting of RNA polymerase II and general transcription factors such as TFIIA, TFIIB, and TFIID. DR1 is a repressor that interacts with the TATA-binding protein (TBP) of TFIID and prevents the formation of an active transcription complex by precluding the entry of TFIIA and/or TFIIB into the preinitiation complex. The protein encoded by this gene is a corepressor of transcription that interacts with DR1 to enhance DR1-mediated repression. The interaction between this corepressor and DR1 is required for corepressor function and appears to stabilize the TBP-DR1-DNA complex. [provided by RefSeq, Jul 2008] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401939 | DRAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401939 | Transient overexpression lysate of DR1-associated protein 1 (negative cofactor 2 alpha) (DRAP1) |
CNY 3080.00 |
|
TP304031 | Recombinant protein of human DR1-associated protein 1 (negative cofactor 2 alpha) (DRAP1), 20 µg |
CNY 2900.00 |
其它NC2 alpha产品