SAT2 (NM_133491) Human Mass Spec Standard
CAT#: PH304044
SAT2 MS Standard C13 and N15-labeled recombinant protein (NP_597998)
View other "SAT2" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | SAT2 MS Standard C13 and N15-labeled recombinant protein (NP_597998) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204044 |
| Predicted MW | 19.2 kDa |
| Protein Sequence |
>RC204044 protein sequence
Red=Cloning site Green=Tags(s) MASVRIREAKEGDCGDILRLIRELAEFEKLSDQVKISEEALRADGFGDNPFYHCLVAEILPAPGKLLGPC VVGYGIYYFIYSTWKGRTIYLEDIYVMPEYRGQGIGSKIIKKVAEVALDKGCSQFRLAVLDWNQRAMDLY KALGAQDLTEAEGWHFFCFQGEATRKLAGK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_597998 |
| RefSeq Size | 983 |
| RefSeq ORF | 510 |
| Synonyms | SSAT2 |
| Locus ID | 112483 |
| Cytogenetics | 17p13.1 |
| Summary | Enzyme which catalyzes the acetylation of polyamines. Substrate specificity: norspermidine > spermidine = spermine >> N(1)acetylspermine = putrescine.[UniProtKB/Swiss-Prot Function] |
| Protein Pathways | Arginine and proline metabolism, Metabolic pathways |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408821 | SAT2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY408821 | Transient overexpression lysate of spermidine/spermine N1-acetyltransferase family member 2 (SAT2) |
CNY 3080.00 |
|
| TP304044 | Recombinant protein of human spermidine/spermine N1-acetyltransferase family member 2 (SAT2), 20 µg |
CNY 2900.00 |
