alpha Tubulin (TUBA3C) (NM_079836) Human Mass Spec Standard
CAT#: PH304072
TUBA3C MS Standard C13 and N15-labeled recombinant protein (NP_524575)
View other "alpha Tubulin" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | TUBA3C MS Standard C13 and N15-labeled recombinant protein (NP_524575) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204072 |
| Predicted MW | 46.1 kDa |
| Protein Sequence |
>RC204072 protein sequence
Red=Cloning site Green=Tags(s) MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDL EPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRIRKLADLCTGLQGFLIFHS FGGGTGSGFASLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIY DICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEK AYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTG FKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDLAALEKDYEEVGVDSVEAEAEEGEEY myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_524575 |
| RefSeq Size | 1408 |
| RefSeq ORF | 1254 |
| Synonyms | bA408E5.3; TUBA2; tubulin, alpha 2; tubulin, alpha 3c |
| Locus ID | 7278 |
| Cytogenetics | 13q12.11 |
| Summary | Microtubules of the eukaryotic cytoskeleton perform essential and diverse functions and are composed of a heterodimer of alpha and beta tubulin. The genes encoding these microtubule constituents are part of the tubulin superfamily, which is composed of six distinct families. Genes from the alpha, beta and gamma tubulin families are found in all eukaryotes. The alpha and beta tubulins represent the major components of microtubules, while gamma tubulin plays a critical role in the nucleation of microtubule assembly. There are multiple alpha and beta tubulin genes and they are highly conserved among and between species. This gene is an alpha tubulin gene that encodes a protein 99% identical to the mouse testis-specific Tuba3 and Tuba7 gene products. This gene is located in the 13q11 region, which is associated with the genetic diseases Clouston hidrotic ectodermal dysplasia and Kabuki syndrome. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Stem cell - Pluripotency |
| Protein Pathways | Gap junction, Pathogenic Escherichia coli infection |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409205 | TUBA3C HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC416933 | TUBA3C HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY409205 | Transient overexpression lysate of tubulin, alpha 3c (TUBA3C), transcript variant 2 |
CNY 3080.00 |
|
| LY416933 | Transient overexpression lysate of tubulin, alpha 3c (TUBA3C) |
CNY 4840.00 |
|
| TP304072 | Recombinant protein of human tubulin, alpha 3c (TUBA3C), transcript variant 2, 20 µg |
CNY 2900.00 |
其它alpha Tubulin产品
