AIPL1 (NM_014336) Human Mass Spec Standard
CAT#: PH304079
AIPL1 MS Standard C13 and N15-labeled recombinant protein (NP_055151)
View other "AIPL1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | AIPL1 MS Standard C13 and N15-labeled recombinant protein (NP_055151) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204079 |
| Predicted MW | 43.9 kDa |
| Protein Sequence |
>RC204079 protein sequence
Red=Cloning site Green=Tags(s) MDAALLLNVEGVKKTILHGGTGELPNFITGSRVIFHFRTMKCDEERTVIDDSRQVGQPMHIIIGNMFKLE VWEILLTSMRVHEVAEFWCDTIHTGVYPILSRSLRQMAQGKDPTEWHVHTCGLANMFAYHTLGYEDLDEL QKEPQPLVFVIELLQVDAPSDYQRETWNLSNHEKMKAVPVLHGEGNRLFKLGRYEEASSKYQEAIICLRN LQTKEKPWEVQWLKLEKMINTLILNYCQCLLKKEEYYEVLEHTSDILRHHPGIVKAYYVRARAHAEVWNE AEAKADLQKVLELEPSMQKAVRRELRLLENRMAEKQEEERLRCRNMLSQGATQPPAEPPTEPPAQSSTEP PAEPPTAPSAELSAGPPAEPATEPPPSPGHSLQH myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_055151 |
| RefSeq Size | 2990 |
| RefSeq ORF | 1152 |
| Synonyms | AIPL2; LCA4 |
| Locus ID | 23746 |
| Cytogenetics | 17p13.2 |
| Summary | Leber congenital amaurosis (LCA) is the most severe inherited retinopathy with the earliest age of onset and accounts for at least 5% of all inherited retinal diseases. Affected individuals are diagnosed at birth or in the first few months of life with nystagmus, severely impaired vision or blindness and an abnormal or flat electroretinogram. The photoreceptor/pineal-expressed gene, AIPL1, encoding aryl-hydrocarbon interacting protein-like 1, is located within the LCA4 candidate region. The encoded protein contains three tetratricopeptide motifs, consistent with chaperone or nuclear transport activity. Mutations in this gene may cause approximately 20% of recessive LCA. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2014] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC415353 | AIPL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY415353 | Transient overexpression lysate of aryl hydrocarbon receptor interacting protein-like 1 (AIPL1), transcript variant 1 |
CNY 3080.00 |
|
| TP304079 | Recombinant protein of human aryl hydrocarbon receptor interacting protein-like 1 (AIPL1), transcript variant 1, 20 µg |
CNY 2900.00 |
