TIGAR (NM_020375) Human Mass Spec Standard
CAT#: PH304087
C12orf5 MS Standard C13 and N15-labeled recombinant protein (NP_065108)
View other "TIGAR" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | C12orf5 MS Standard C13 and N15-labeled recombinant protein (NP_065108) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204087 |
Predicted MW | 30.1 kDa |
Protein Sequence |
>RC204087 protein sequence
Red=Cloning site Green=Tags(s) MARFALTVVRHGETRFNKEKIIQGQGVDEPLSETGFKQAAAAGIFLNNVKFTHAFSSDLMRTKQTMHGIL ERSKFCKDMTVKYDSRLRERKYGVVEGKALSELRAMAKAAREECPVFTPPGGETLDQVKMRGIDFFEFLC QLILKEADQKEQFSQGSPSNCLETSLAEIFPLGKNHSSKVNSDSGIPGLAASVLVVSHGAYMRSLFDYFL TDLKCSLPATLSRSELMSVTPNTGMSLFIINFEEGREVKPTVQCICMNLQDHLNGLTETR myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_065108 |
RefSeq Size | 8237 |
RefSeq ORF | 810 |
Synonyms | C12orf5; FR2BP |
Locus ID | 57103 |
Cytogenetics | 12p13.32 |
Summary | This gene is regulated as part of the p53 tumor suppressor pathway and encodes a protein with sequence similarity to the bisphosphate domain of the glycolytic enzyme that degrades fructose-2,6-bisphosphate. The protein functions by blocking glycolysis and directing the pathway into the pentose phosphate shunt. Expression of this protein also protects cells from DNA damaging reactive oxygen species and provides some protection from DNA damage-induced apoptosis. The 12p13.32 region that includes this gene is paralogous to the 11q13.3 region. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412517 | C12orf5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY412517 | Transient overexpression lysate of chromosome 12 open reading frame 5 (C12orf5) |
CNY 3080.00 |
|
TP304087 | Recombinant protein of human chromosome 12 open reading frame 5 (C12orf5), 20 µg |
CNY 2900.00 |