NKIRAS1 (NM_020345) Human Mass Spec Standard
CAT#: PH304248
NKIRAS1 MS Standard C13 and N15-labeled recombinant protein (NP_065078)
View other "NKIRAS1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | NKIRAS1 MS Standard C13 and N15-labeled recombinant protein (NP_065078) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204248 |
| Predicted MW | 21.6 kDa |
| Protein Sequence |
>RC204248 protein sequence
Red=Cloning site Green=Tags(s) MGKGCKVVVCGLLSVGKTAILEQLLYGNHTIGMEDCETMEDVYMASVETDRGVKEQLHLYDTRGLQEGVE LPKHYFSFADGFVLVYSVNNLESFQRVELLKKEIDKFKDKKEVAIVVLGNKIDLSEQRQVDAEVAQQWAK SEKVRLWEVTVTDRKTLIEPFTLLASKLSQPQSKSSFPLPGRKNKGNSNSEN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_065078 |
| RefSeq Size | 2013 |
| RefSeq ORF | 576 |
| Synonyms | kappaB-Ras1; KBRAS1 |
| Locus ID | 28512 |
| Cytogenetics | 3p24.2 |
| Summary | Atypical Ras-like protein that acts as a potent regulator of NF-kappa-B activity by preventing the degradation of NF-kappa-B inhibitor beta (NFKBIB) by most signals, explaining why NFKBIB is more resistant to degradation. May act by blocking phosphorylation of NFKBIB and mediating cytoplasmic retention of p65/RELA NF-kappa-B subunit. It is unclear whether it acts as a GTPase. Both GTP- and GDP-bound forms block phosphorylation of NFKBIB.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC412541 | NKIRAS1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY412541 | Transient overexpression lysate of NFKB inhibitor interacting Ras-like 1 (NKIRAS1) |
CNY 3080.00 |
|
| TP304248 | Recombinant protein of human NFKB inhibitor interacting Ras-like 1 (NKIRAS1), 20 µg |
CNY 2900.00 |
其它NKIRAS1产品
