NT5C (NM_014595) Human Mass Spec Standard
CAT#: PH304265
NT5C MS Standard C13 and N15-labeled recombinant protein (NP_055410)
View other "NT5C" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | NT5C MS Standard C13 and N15-labeled recombinant protein (NP_055410) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204265 |
Predicted MW | 23.4 kDa |
Protein Sequence |
>RC204265 protein sequence
Red=Cloning site Green=Tags(s) MARSVRVLVDMDGVLADFEAGLLRGFRRRFPEEPHVPLEQRRGFLAREQYRALRPDLADKVASVYEAPGF FLDLEPIPGALDAVREMNDLPDTQVFICTSPLLKYHHCVGEKYRWVEQHLGPQFVERIILTRDKTVVLGD LLIDDKDTVRGQEETPSWEHILFTCCHNRHLVLPPTRRRLLSWSDNWREILDSKRGAAQRE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_055410 |
RefSeq Size | 975 |
RefSeq ORF | 603 |
Synonyms | cdN; DNT; dNT-1; DNT1; HEL74; P5N2; PN-I; PN-II; UMPH2 |
Locus ID | 30833 |
Cytogenetics | 17q25.1 |
Summary | This gene encodes a nucleotidase that catalyzes the dephosphorylation of the 5' deoxyribonucleotides (dNTP) and 2'(3')-dNTP and ribonucleotides, but not 5' ribonucleotides. Of the different forms of nucleotidases characterized, this enzyme is unique in its preference for 5'-dNTP. It may be one of the enzymes involved in regulating the size of dNTP pools in cells. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Nov 2011] |
Protein Families | Transcription Factors |
Protein Pathways | Metabolic pathways, Nicotinate and nicotinamide metabolism, Purine metabolism, Pyrimidine metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415175 | NT5C HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415175 | Transient overexpression lysate of 5', 3'-nucleotidase, cytosolic (NT5C) |
CNY 3080.00 |
|
TP304265 | Recombinant protein of human 5', 3'-nucleotidase, cytosolic (NT5C), 20 µg |
CNY 2900.00 |