SHC (SHC1) (NM_003029) Human Mass Spec Standard
CAT#: PH304362
SHC1 MS Standard C13 and N15-labeled recombinant protein (NP_003020)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
CNY 4840.00
Specifications
Product Data | |
Description | SHC1 MS Standard C13 and N15-labeled recombinant protein (NP_003020) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204362 |
Predicted MW | 51.7 kDa |
Protein Sequence |
>RC204362 protein sequence
Red=Cloning site Green=Tags(s) MNKLSGGGGRRTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGCVEVLQSMRALD FNTRTQVTREAISLVCEAVPGAKGATRRRKPCSRPLSSILGRSNLKFAGMPITLTVSTSSLNLMAADCKQ IIANHHMQSISFASGGDPDTAEYVAYVAKDPVNQRACHILECPEGLAQDVISTIGQAFELRFKQYLRNPP KLVTPHDRMAGFDGSAWDEEEEEPPDHQYYNDFPGKEPPLGGVVDMRLREGAAPGAARPTAPNAQTPSHL GATLPVGQPVGGDPEVRKQMPPPPPCPAGRELFDDPSYVNVQNLDKARQAVGGAGPPNPAINGSAPRDLF DMKPFEDALRVPPPPQSVSMAEQLRGEPWFHGKLSRREAEALLQLNGDFLVRESTTTPGQYVLTGLQSGQ PKHLLLVDPEGVVRTKDHRFESVSHLISYHMDNHLPIISAGSELCLQQPVERKL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003020 |
RefSeq Size | 3195 |
RefSeq ORF | 1422 |
Synonyms | SHC; SHCA |
Locus ID | 6464 |
Cytogenetics | 1q21.3 |
Summary | This gene encodes three main isoforms that differ in activities and subcellular location. While all three are adapter proteins in signal transduction pathways, the longest (p66Shc) may be involved in regulating life span and the effects of reactive oxygen species. The other two isoforms, p52Shc and p46Shc, link activated receptor tyrosine kinases to the Ras pathway by recruitment of the GRB2/SOS complex. p66Shc is not involved in Ras activation. Unlike the other two isoforms, p46Shc is targeted to the mitochondrial matrix. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2011] |
Protein Families | Druggable Genome |
Protein Pathways | Adherens junction, Arrhythmogenic right ventricular cardiomyopathy (ARVC), Chemokine signaling pathway, Chronic myeloid leukemia, Dilated cardiomyopathy, ErbB signaling pathway, Focal adhesion, Glioma, Hypertrophic cardiomyopathy (HCM), Insulin signaling pathway, Leukocyte transendothelial migration, Natural killer cell mediated cytotoxicity, Neurotrophin signaling pathway, Pathogenic Escherichia coli infection, Regulation of actin cytoskeleton, Tight junction, Vibrio cholerae infection, Viral myocarditis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401060 | SHC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC405300 | SHC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC427121 | SHC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401060 | Transient overexpression lysate of SHC (Src homology 2 domain containing) transforming protein 1 (SHC1), transcript variant 2 |
CNY 3080.00 |
|
LY405300 | Transient overexpression lysate of SHC (Src homology 2 domain containing) transforming protein 1 (SHC1), transcript variant 1 |
CNY 4840.00 |
|
LY427121 | Transient overexpression lysate of SHC (Src homology 2 domain containing) transforming protein 1 (SHC1), transcript variant 3 |
CNY 3080.00 |
|
TP304362 | Recombinant protein of human SHC (Src homology 2 domain containing) transforming protein 1 (SHC1), transcript variant 2, 20 µg |
CNY 2900.00 |