NUDT18 (NM_024815) Human Mass Spec Standard
CAT#: PH304376
NUDT18 MS Standard C13 and N15-labeled recombinant protein (NP_079091)
View other "NUDT18" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | NUDT18 MS Standard C13 and N15-labeled recombinant protein (NP_079091) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204376 |
| Predicted MW | 35.3 kDa |
| Protein Sequence |
>RC204376 representing NM_024815
Red=Cloning site Green=Tags(s) MASEGLAGALASVLAGQGSSVHSCDSAPAGEPPAPVRLRKNVCYVVLAVFLSEQDEVLLIQEAKRECRGS WYLPAGRMEPGETIVEALQREVKEEAGLHCEPETLLSVEERGPSWVRFVFLARPTGGILKTSKEADAESL QAAWYPRTSLPTPLRAHDILHLVELAAQYRQQARHPLILPQELPCDLVCQRLVATFTSAQTVWVLVGTVG MPHLPVTACGLDPMEQRGGMKMAVLRLLQECLTLHHLVVEIKGLLGLQHLGRDHSDGICLNVLVTVAFRS PGIQDEPPKVRGENFSWWKVMEEDLQSQLLQRLQGSSVVPVNR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_079091 |
| RefSeq Size | 1519 |
| RefSeq ORF | 969 |
| Synonyms | MTH3 |
| Locus ID | 79873 |
| Cytogenetics | 8p21.3 |
| Summary | The protein encoded by this gene is a member of the Nudix hydrolase family. Nudix hydrolases eliminate potentially toxic nucleotide metabolites from the cell and regulate the concentrations and availability of many different nucleotide substrates, cofactors, and signaling molecules. This protein contains a Nudix hydrolase domain and hydrolyzes oxidized forms of guanosine and deoxyguanosine diphosphates. [provided by RefSeq, Sep 2012] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403033 | NUDT18 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403033 | Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 18 (NUDT18) |
CNY 3080.00 |
|
| TP304376 | Recombinant protein of human nudix (nucleoside diphosphate linked moiety X)-type motif 18 (NUDT18), 20 µg |
CNY 2900.00 |
