FAIM1 (FAIM) (NM_001033032) Human Mass Spec Standard
CAT#: PH304411
FAIM MS Standard C13 and N15-labeled recombinant protein (NP_001028204)
View other "FAIM1" proteins (6)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | FAIM MS Standard C13 and N15-labeled recombinant protein (NP_001028204) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204411 |
| Predicted MW | 20.2 kDa |
| Protein Sequence |
>RC204411 protein sequence
Red=Cloning site Green=Tags(s) MTDLVAVWDVALSDGVHKIEFEHGTTSGKRVVYVDGKEEIRKEWMFKLVGKETFYVGAAKTKATINIDAI SGFAYEYTLEINGKSLKKYMEDRSKTTNTWVLHMDGENFRIVLEKDAMDVWCNGKKLETAGEFVDDGTET HFSIGNHDCYIKAVSSGKRKEGIIHTLIVDNREIPEIAS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001028204 |
| RefSeq Size | 1104 |
| RefSeq ORF | 537 |
| Synonyms | FAIM1 |
| Locus ID | 55179 |
| Cytogenetics | 3q22.3 |
| Summary | The protein encoded by this gene protects against death receptor-triggered apoptosis and regulates B-cell signaling and differentiation. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2011] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC413277 | FAIM HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422347 | FAIM HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY413277 | Transient overexpression lysate of Fas apoptotic inhibitory molecule (FAIM), transcript variant 4 |
CNY 3080.00 |
|
| LY422347 | Transient overexpression lysate of Fas apoptotic inhibitory molecule (FAIM), transcript variant 3 |
CNY 3080.00 |
|
| TP304411 | Recombinant protein of human Fas apoptotic inhibitory molecule (FAIM), transcript variant 3, 20 µg |
CNY 2900.00 |
|
| TP762644 | Purified recombinant protein of Human Fas apoptotic inhibitory molecule (FAIM), transcript variant 4, full length, with N-GST and C-His tag, expressed in E.coli, 50ug |
CNY 2480.00 |
