CHIC2 (NM_012110) Human Mass Spec Standard
CAT#: PH304420
CHIC2 MS Standard C13 and N15-labeled recombinant protein (NP_036242)
View other "CHIC2" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | CHIC2 MS Standard C13 and N15-labeled recombinant protein (NP_036242) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204420 |
| Predicted MW | 19.3 kDa |
| Protein Sequence |
>RC204420 protein sequence
Red=Cloning site Green=Tags(s) MADFDEIYEEEEDEERALEEQLLKYSPDPVVVRGSGHVTVFGLSNKFESEFPSSLTGKVAPEEFKASINR VNSCLKKNLPVNVRWLLCGCLCCCCTLGCSMWPVICLSKRTRRSIEKLLEWENNRLYHKLCLHWRLSKRK CETNNMMEYVILIEFLPKTPIFRPD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_036242 |
| RefSeq Size | 1178 |
| RefSeq ORF | 495 |
| Synonyms | BTL |
| Locus ID | 26511 |
| Cytogenetics | 4q12 |
| Summary | This gene encodes a member of the CHIC family of proteins. The encoded protein contains a cysteine-rich hydrophobic (CHIC) motif, and is localized to vesicular structures and the plasma membrane. This gene is associated with some cases of acute myeloid leukemia. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC415979 | CHIC2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY415979 | Transient overexpression lysate of cysteine-rich hydrophobic domain 2 (CHIC2) |
CNY 3080.00 |
|
| TP304420 | Recombinant protein of human cysteine-rich hydrophobic domain 2 (CHIC2), 20 µg |
CNY 2900.00 |
