CHIC2 (NM_012110) Human Mass Spec Standard
CAT#: PH304420
CHIC2 MS Standard C13 and N15-labeled recombinant protein (NP_036242)
View other "CHIC2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | CHIC2 MS Standard C13 and N15-labeled recombinant protein (NP_036242) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204420 |
Predicted MW | 19.3 kDa |
Protein Sequence |
>RC204420 protein sequence
Red=Cloning site Green=Tags(s) MADFDEIYEEEEDEERALEEQLLKYSPDPVVVRGSGHVTVFGLSNKFESEFPSSLTGKVAPEEFKASINR VNSCLKKNLPVNVRWLLCGCLCCCCTLGCSMWPVICLSKRTRRSIEKLLEWENNRLYHKLCLHWRLSKRK CETNNMMEYVILIEFLPKTPIFRPD myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_036242 |
RefSeq Size | 1178 |
RefSeq ORF | 495 |
Synonyms | BTL |
Locus ID | 26511 |
Cytogenetics | 4q12 |
Summary | This gene encodes a member of the CHIC family of proteins. The encoded protein contains a cysteine-rich hydrophobic (CHIC) motif, and is localized to vesicular structures and the plasma membrane. This gene is associated with some cases of acute myeloid leukemia. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415979 | CHIC2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415979 | Transient overexpression lysate of cysteine-rich hydrophobic domain 2 (CHIC2) |
CNY 3080.00 |
|
TP304420 | Recombinant protein of human cysteine-rich hydrophobic domain 2 (CHIC2), 20 µg |
CNY 2900.00 |