ICT1 (MRPL58) (NM_001545) Human Mass Spec Standard
CAT#: PH304448
ICT1 MS Standard C13 and N15-labeled recombinant protein (NP_001536)
View other "ICT1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | ICT1 MS Standard C13 and N15-labeled recombinant protein (NP_001536) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204448 |
| Predicted MW | 23.6 kDa |
| Protein Sequence |
>RC204448 protein sequence
Red=Cloning site Green=Tags(s) MAATRCLRWGLSRAGVWLLPPPARCPRRALHKQKDGTEFKSIYSLDKLYPESQGSDTAWRVPNGAKQADS DIPLDRLTISYCRSSGPGGQNVNKVNSKAEVRFHLATAEWIAEPVRQKIAITHKNKINRLGELILTSESS RYQFRNLADCLQKIRDMITEASQTPKEPTKEDVKLHRIRIENMNRERLRQKRIHSAVKTSRRVDMD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001536 |
| RefSeq Size | 888 |
| RefSeq ORF | 618 |
| Synonyms | DS-1; DS1; ICT1; MRP-L58 |
| Locus ID | 3396 |
| Cytogenetics | 17q25.1 |
| Summary | The protein encoded by this gene is a peptidyl-tRNA hydrolase and a vital component of the large mitochondrial ribosome. The encoded protein serves as a ribosome release factor for this ribosome, which translates mitochondrial genes. This protein may be responsible for degrading prematurely-terminated polypeptides and for reusing stalled ribosomes. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2014] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419875 | ICT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY419875 | Transient overexpression lysate of immature colon carcinoma transcript 1 (ICT1) |
CNY 3080.00 |
|
| TP304448 | Recombinant protein of human immature colon carcinoma transcript 1 (ICT1), 20 µg |
CNY 2900.00 |
