RND3 (NM_005168) Human Mass Spec Standard
CAT#: PH304479
RND3 MS Standard C13 and N15-labeled recombinant protein (NP_005159)
View other "RND3" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | RND3 MS Standard C13 and N15-labeled recombinant protein (NP_005159) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204479 |
| Predicted MW | 27.4 kDa |
| Protein Sequence |
>RC204479 protein sequence
Red=Cloning site Green=Tags(s) MKERRASQKLSSKSIMDPNQNVKCKIVVVGDSQCGKTALLHVFAKDCFPENYVPTVFENYTASFEIDTQR IELSLWDTSGSPYYDNVRPLSYPDSDAVLICFDISRPETLDSVLKKWKGEIQEFCPNTKMLLVGCKSDLR TDVSTLVELSNHRQTPVSYDQGANMAKQIGAATYIECSALQSENSVRDIFHVATLACVNKTNKNVKRNKS QRATKRISHMPSRPELSAVATDLRKDKAKSCTVM myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_005159 |
| RefSeq Size | 2712 |
| RefSeq ORF | 732 |
| Synonyms | ARHE; memB; Rho8; RhoE |
| Locus ID | 390 |
| Cytogenetics | 2q23.3 |
| Summary | This gene encodes a protein which is a member of the small GTPase protein superfamily. The encoded protein binds only GTP but has no GTPase activity, and appears to act as a negative regulator of cytoskeletal organization leading to loss of adhesion. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Dec 2011] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417471 | RND3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY417471 | Transient overexpression lysate of Rho family GTPase 3 (RND3) |
CNY 3080.00 |
|
| TP304479 | Recombinant protein of human Rho family GTPase 3 (RND3), 20 µg |
CNY 2900.00 |
