MEK6 (MAP2K6) (NM_002758) Human Mass Spec Standard
CAT#: PH304481
MAP2K6 MS Standard C13 and N15-labeled recombinant protein (NP_002749)
View other "MEK6" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | MAP2K6 MS Standard C13 and N15-labeled recombinant protein (NP_002749) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204481 |
Predicted MW | 37.5 kDa |
Protein Sequence |
>RC204481 protein sequence
Red=Cloning site Green=Tags(s) MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELGRGAYGVVEKM RHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFY KQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDSVAK TIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPA DKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002749 |
RefSeq Size | 1879 |
RefSeq ORF | 1002 |
Synonyms | MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3 |
Locus ID | 5608 |
Cytogenetics | 17q24.3 |
Summary | This gene encodes a member of the dual specificity protein kinase family, which functions as a mitogen-activated protein (MAP) kinase kinase. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals. This protein phosphorylates and activates p38 MAP kinase in response to inflammatory cytokines or environmental stress. As an essential component of p38 MAP kinase mediated signal transduction pathway, this gene is involved in many cellular processes such as stress induced cell cycle arrest, transcription activation and apoptosis. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Protein Kinase |
Protein Pathways | Amyotrophic lateral sclerosis (ALS), Fc epsilon RI signaling pathway, GnRH signaling pathway, MAPK signaling pathway, Toll-like receptor signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400975 | MAP2K6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400975 | Transient overexpression lysate of mitogen-activated protein kinase kinase 6 (MAP2K6) |
CNY 3080.00 |
|
TP304481 | Recombinant protein of human mitogen-activated protein kinase kinase 6 (MAP2K6), 20 µg |
CNY 2900.00 |