Psoriasin (S100A7) (NM_002963) Human Mass Spec Standard
CAT#: PH304490
S100A7 MS Standard C13 and N15-labeled recombinant protein (NP_002954)
View other "Psoriasin" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | S100A7 MS Standard C13 and N15-labeled recombinant protein (NP_002954) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204490 |
| Predicted MW | 11.5 kDa |
| Protein Sequence |
>RC204490 protein sequence
Red=Cloning site Green=Tags(s) MSNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKI DFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002954 |
| RefSeq Size | 450 |
| RefSeq ORF | 303 |
| Synonyms | PSOR1; S100A7c |
| Locus ID | 6278 |
| Cytogenetics | 1q21.3 |
| Summary | The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein differs from the other S100 proteins of known structure in its lack of calcium binding ability in one EF-hand at the N-terminus. The protein is overexpressed in hyperproliferative skin diseases, exhibits antimicrobial activities against bacteria and induces immunomodulatory activities. [provided by RefSeq, Nov 2014] |
| Protein Families | Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418993 | S100A7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY418993 | Transient overexpression lysate of S100 calcium binding protein A7 (S100A7) |
CNY 3080.00 |
|
| TP304490 | Recombinant protein of human S100 calcium binding protein A7 (S100A7), 20 µg |
CNY 2900.00 |
其它Psoriasin产品
