MITD1 (NM_138798) Human Mass Spec Standard
CAT#: PH304503
MITD1 MS Standard C13 and N15-labeled recombinant protein (NP_620153)
View other "MITD1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | MITD1 MS Standard C13 and N15-labeled recombinant protein (NP_620153) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204503 |
Predicted MW | 29.3 kDa |
Protein Sequence |
>RC204503 protein sequence
Red=Cloning site Green=Tags(s) MAKSGLRQDPQSTAAATVLKRAVELDSESRYPQALVCYQEGIDLLLQVLKGTKDNTKRCNLREKISKYMD RAENIKKYLDQEKEDGKYHKQIKIEENATGFSYESLFREYLNETVTEVWIEDPYIRHTHQLYNFLRFCEM LIKRPCKVKTIHLLTSLDEGIEQVQQSRGLQEIEESLRSHGVLLEVQYSSSIHDREIRFNNGWMIKIGRG LDYFKKPQSRFSLGYCDFDLRPCHETTVDIFHKKHTKNI myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_620153 |
RefSeq Size | 963 |
RefSeq ORF | 747 |
Locus ID | 129531 |
Cytogenetics | 2q11.2 |
Summary | Abscission, the separation of daughter cells at the end of cytokinesis, is effected by endosomal sorting complexes required for transport III (ESCRT-III). The protein encoded by this gene functions as a homodimer, with the N-termini binding to a subset of ESCRT-III subunits and the C-termini binding to membranes. The encoded protein regulates ESCRT-III activity and is required for proper cytokinesis. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2016] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408484 | MITD1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408484 | Transient overexpression lysate of MIT, microtubule interacting and transport, domain containing 1 (MITD1) |
CNY 3080.00 |
|
TP304503 | Recombinant protein of human MIT, microtubule interacting and transport, domain containing 1 (MITD1), 20 µg |
CNY 2900.00 |