HLA-DQB2 (NM_182549) Human Mass Spec Standard
CAT#: PH304511
HLA MS Standard C13 and N15-labeled recombinant protein (NP_872355)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | HLA MS Standard C13 and N15-labeled recombinant protein (NP_872355) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204511 |
Predicted MW | 27 kDa |
Protein Sequence |
>RC204511 representing NM_182549
Red=Cloning site Green=Tags(s) MSWKMALQIPGGFWAAAVTVMLVMLSTPVAEARDFPKDFLVQFKGMCYFTNGTERVRGVARYIYNREEYG RFDSDVGEFQAVTELGRSIEDWNNYKDFLEQERAAVDKVCRHNYEAELRTTLQRQVEPTVTISPSRTEAL NHHNLLVCSVTDFYPAQIKVQWFRNDQEETAGVVSTSLIRNGDWTFQILVMLEITPQRGDIYTCQVEHPS LQSPITVEWRPRGPPPAGLLH myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_872355 |
RefSeq Size | 1092 |
RefSeq ORF | 693 |
Synonyms | HLA-DQB1; HLA-DXB |
Locus ID | 3120 |
Cytogenetics | 6p21.32 |
Summary | HLA-DQB2 belongs to the family of HLA class II beta chain paralogs. Class II molecules are heterodimers consisting of an alpha (DQA) and a beta chain (DQB), both anchored in the membrane. They play a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). Polymorphisms in the alpha and beta chains specify the peptide binding specificity, and typing for these polymorphisms is routinely done for bone marrow transplantation. However this gene, HLA-DQB2, is not routinely typed, as it is not thought to have an effect on transplantation. There is conflicting evidence in the literature and public sequence databases for the protein-coding capacity of HLA-DQB2. Because there is evidence of transcription and an intact ORF, HLA-DQB2 is represented in Entrez Gene and in RefSeq as a protein-coding locus. [provided by RefSeq, Oct 2010] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403637 | HLA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403637 | Transient overexpression lysate of major histocompatibility complex, class II, DQ beta 2 (HLA-DQB2) |
CNY 3080.00 |
|
TP304511 | Recombinant protein of human major histocompatibility complex, class II, DQ beta 2 (HLA-DQB2), 20 µg |
CNY 2900.00 |