CD95 (FAS) (NM_000043) Human Mass Spec Standard
CAT#: PH304520
FAS MS Standard C13 and N15-labeled recombinant protein (NP_000034)
View other "CD95" proteins (9)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
Product Data | |
Description | FAS MS Standard C13 and N15-labeled recombinant protein (NP_000034) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204520 |
Predicted MW | 37.7 kDa |
Protein Sequence |
>RC204520 protein sequence
Red=Cloning site Green=Tags(s) MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKA RDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVC EHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSNLGWLCLLLLPIPLIVWVKRKEVQKTCRKHRKENQGSH ESPTLNPETVAINLSDVDLSKYITTIAGVMTLSQVKGFVRKNGVNEAKIDEIKNDNVQDTAEQKVQLLRN WHQLHGKKEAYDTLIKDLKKANLCTLAEKIQTIILKDITSDSENSNFRNEIQSLV myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000034 |
RefSeq Size | 2755 |
RefSeq ORF | 1005 |
Synonyms | ALPS1A; APO-1; APT1; CD95; FAS1; FASTM; TNFRSF6 |
Locus ID | 355 |
Cytogenetics | 10q23.31 |
Summary | The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor contains a death domain. It has been shown to play a central role in the physiological regulation of programmed cell death, and has been implicated in the pathogenesis of various malignancies and diseases of the immune system. The interaction of this receptor with its ligand allows the formation of a death-inducing signaling complex that includes Fas-associated death domain protein (FADD), caspase 8, and caspase 10. The autoproteolytic processing of the caspases in the complex triggers a downstream caspase cascade, and leads to apoptosis. This receptor has been also shown to activate NF-kappaB, MAPK3/ERK1, and MAPK8/JNK, and is found to be involved in transducing the proliferating signals in normal diploid fibroblast and T cells. Several alternatively spliced transcript variants have been described, some of which are candidates for nonsense-mediated mRNA decay (NMD). The isoforms lacking the transmembrane domain may negatively regulate the apoptosis mediated by the full length isoform. [provided by RefSeq, Mar 2011] |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein |
Protein Pathways | Allograft rejection, Alzheimer's disease, Apoptosis, Autoimmune thyroid disease, Cytokine-cytokine receptor interaction, Graft-versus-host disease, MAPK signaling pathway, Natural killer cell mediated cytotoxicity, p53 signaling pathway, Pathways in cancer, Type I diabetes mellitus |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407241 | FAS HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC407246 | FAS HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC424961 | FAS HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY407241 | Transient overexpression lysate of Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 2 |
CNY 3080.00 |
|
LY407246 | Transient overexpression lysate of Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 6 |
CNY 3080.00 |
|
LY424961 | Transient overexpression lysate of Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 1 |
CNY 3080.00 |
|
TP304520 | Recombinant protein of human Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP721062 | Purified recombinant protein of Human Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 1 |
CNY 1800.00 |
|
TP761886 | Purified recombinant protein of Human Fas (TNF receptor superfamily, member 6) (FAS), transcript variant 6, full length, with N-terminal GST and C-terminal His tag,, expressed in E. coli, 50ug |
CNY 2040.00 |