GSTA3 (NM_000847) Human Mass Spec Standard
CAT#: PH304624
GSTA3 MS Standard C13 and N15-labeled recombinant protein (NP_000838)
View other "GSTA3" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | GSTA3 MS Standard C13 and N15-labeled recombinant protein (NP_000838) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204624 |
Predicted MW | 25.3 kDa |
Protein Sequence |
>RC204624 protein sequence
Red=Cloning site Green=Tags(s) MAGKPKLHYFNGRGRMEPIRWLLAAAGVEFEEKFIGSAEDLGKLRNDGSLMFQQVPMVEIDGIKLVQTRA ILNYIASKYNLYGKDIKERALIDMYTEGMADLNEMILLLPLCRPEEKDAKIALIKEKTKSRYFPAFEKVL QSHGQDYLVGNKLSRADISLVELLYYVEELDSSLISNFPLLKALKTRISNLPTVKKFLQPGSPRKPPADA KALEEARKIFRF myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000838 |
RefSeq Size | 915 |
RefSeq ORF | 666 |
Synonyms | GSTA3-3; GTA3 |
Locus ID | 2940 |
Cytogenetics | 6p12.2 |
Summary | Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes are involved in cellular defense against toxic, carcinogenic, and pharmacologically active electrophilic compounds. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-tranferase belonging to the alpha class genes that are located in a cluster mapped to chromosome 6. Genes of the alpha class are highly related and encode enzymes with glutathione peroxidase activity. However, during evolution, this alpha class gene diverged accumulating mutations in the active site that resulted in differences in substrate specificity and catalytic activity. The enzyme encoded by this gene catalyzes the double bond isomerization of precursors for progesterone and testosterone during the biosynthesis of steroid hormones. An additional transcript variant has been identified, but its full length sequence has not been determined. [provided by RefSeq, Jul 2008] |
Protein Pathways | Drug metabolism - cytochrome P450, Glutathione metabolism, Metabolism of xenobiotics by cytochrome P450 |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424489 | GSTA3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY424489 | Transient overexpression lysate of glutathione S-transferase alpha 3 (GSTA3) |
CNY 3080.00 |
|
TP304624 | Recombinant protein of human glutathione S-transferase alpha 3 (GSTA3), 20 µg |
CNY 2900.00 |