EVA1 (MPZL2) (NM_005797) Human Mass Spec Standard
CAT#: PH304628
MPZL2 MS Standard C13 and N15-labeled recombinant protein (NP_005788)
View other "EVA1" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | MPZL2 MS Standard C13 and N15-labeled recombinant protein (NP_005788) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204628 |
Predicted MW | 24.5 kDa |
Protein Sequence |
>RC204628 protein sequence
Red=Cloning site Green=Tags(s) MYGKSSTRAVLLLLGIQLTALWPIAAVEIYTSRVLEAVNGTDARLKCTFSSFAPVGDALTVTWNFRPLDG GPEQFVFYYHIDPFQPMSGRFKDRVSWDGNPERYDASILLWKLQFDDNGTYTCQVKNPPDVDGVIGEIRL SVVHTVRFSEIHFLALAIGSACALMIIIVIVVVLFQHYRKKRWAERAHKVVEIKSKEEERLNQEKKVSVY LEDTD myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005788 |
RefSeq Size | 2871 |
RefSeq ORF | 645 |
Synonyms | DFNB111; EVA; EVA1 |
Locus ID | 10205 |
Cytogenetics | 11q23.3 |
Summary | Thymus development depends on a complex series of interactions between thymocytes and the stromal component of the organ. Epithelial V-like antigen (EVA) is expressed in thymus epithelium and strongly downregulated by thymocyte developmental progression. This gene is expressed in the thymus and in several epithelial structures early in embryogenesis. It is highly homologous to the myelin protein zero and, in thymus-derived epithelial cell lines, is poorly soluble in nonionic detergents, strongly suggesting an association to the cytoskeleton. Its capacity to mediate cell adhesion through a homophilic interaction and its selective regulation by T cell maturation might imply the participation of EVA in the earliest phases of thymus organogenesis. The protein bears a characteristic V-type domain and two potential N-glycosylation sites in the extracellular domain; a putative serine phosphorylation site for casein kinase 2 is also present in the cytoplasmic tail. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403409 | MPZL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC417083 | MPZL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403409 | Transient overexpression lysate of myelin protein zero-like 2 (MPZL2), transcript variant 2 |
CNY 3080.00 |
|
LY417083 | Transient overexpression lysate of myelin protein zero-like 2 (MPZL2), transcript variant 1 |
CNY 3080.00 |
|
PH323753 | MPZL2 MS Standard C13 and N15-labeled recombinant protein (NP_658911) |
CNY 19520.00 |
|
TP304628 | Recombinant protein of human myelin protein zero-like 2 (MPZL2), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP323753 | Recombinant protein of human myelin protein zero-like 2 (MPZL2), transcript variant 2, 20 µg |
CNY 2900.00 |