RBP4 (NM_006744) Human Mass Spec Standard
CAT#: PH304635
RBP4 MS Standard C13 and N15-labeled recombinant protein (NP_006735)
View other "RBP4" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | RBP4 MS Standard C13 and N15-labeled recombinant protein (NP_006735) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204635 |
| Predicted MW | 23 kDa |
| Protein Sequence |
>RC204635 protein sequence
Red=Cloning site Green=Tags(s) MKWVWALFLLAALGSGRAERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQ MSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRL LNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_006735 |
| RefSeq Size | 941 |
| RefSeq ORF | 603 |
| Synonyms | MCOPCB10; RDCCAS |
| Locus ID | 5950 |
| Cytogenetics | 10q23.33 |
| Summary | This protein belongs to the lipocalin family and is the specific carrier for retinol (vitamin A alcohol) in the blood. It delivers retinol from the liver stores to the peripheral tissues. In plasma, the RBP-retinol complex interacts with transthyretin which prevents its loss by filtration through the kidney glomeruli. A deficiency of vitamin A blocks secretion of the binding protein posttranslationally and results in defective delivery and supply to the epidermal cells. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402016 | RBP4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402016 | Transient overexpression lysate of retinol binding protein 4, plasma (RBP4) |
CNY 3080.00 |
|
| TP304635 | Recombinant protein of human retinol binding protein 4, plasma (RBP4), 20 µg |
CNY 2900.00 |
|
| TP720147 | Recombinant protein of human retinol binding protein 4, plasma (RBP4) |
CNY 1800.00 |
