BAFF (TNFSF13B) (NM_006573) Human Mass Spec Standard
CAT#: PH304672
TNFSF13B MS Standard C13 and N15-labeled recombinant protein (NP_006564)
View other "BAFF" proteins (6)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | TNFSF13B MS Standard C13 and N15-labeled recombinant protein (NP_006564) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204672 |
| Predicted MW | 31.2 kDa |
| Protein Sequence |
>RC204672 protein sequence
Red=Cloning site Green=Tags(s) MDDSTEREQSRLTSCLKKREEMKLKECVSILPRKESPSVRSSKDGKLLAATLLLALLSCCLTVVSFYQVA ALQGDLASLRAELQGHHAEKLPAGAGAPKAGLEEAPAVTAGLKIFEPPAPGEGNSSQNSRNKRAVQGPEE TVTQDCLQLIADSETPTIQKGSYTFVPWLLSFKRGSALEEKENKILVKETGYFFIYGQVLYTDKTYAMGH LIQRKKVHVFGDELSLVTLFRCIQNMPETLPNNSCYSAGIAKLEEGDELQLAIPRENAQISLDGDVTFFG ALKLL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_006564 |
| RefSeq Size | 2675 |
| RefSeq ORF | 855 |
| Synonyms | BAFF; BLYS; CD257; DTL; TALL-1; TALL1; THANK; TNFSF20; TNLG7A; ZTNF4 |
| Locus ID | 10673 |
| Cytogenetics | 13q33.3 |
| Summary | The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for receptors TNFRSF13B/TACI, TNFRSF17/BCMA, and TNFRSF13C/BAFFR. This cytokine is expressed in B cell lineage cells, and acts as a potent B cell activator. It has been also shown to play an important role in the proliferation and differentiation of B cells. Alternatively spliced transcript variants encoding distinct isoforms have been identified. [provided by RefSeq, Mar 2011] |
| Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
| Protein Pathways | Cytokine-cytokine receptor interaction |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401966 | TNFSF13B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401966 | Transient overexpression lysate of tumor necrosis factor (ligand) superfamily, member 13b (TNFSF13B), transcript variant 1 |
CNY 3080.00 |
|
| TP304672 | Recombinant protein of human tumor necrosis factor (ligand) superfamily, member 13b (TNFSF13B), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP700008 | Recombinant protein of human tumor necrosis factor (ligand) superfamily, member 13b (TNFSF13B), transcript variant 1, secreted soluble form with N-terminal His tag, expressed in human cells |
CNY 6650.00 |
|
| TP723963 | Human BAFF Protein, hFc Tag |
CNY 5876.00 |
|
| TP750018 | Recombinant protein of human soluble BAFF (TNFSF13B) produced in E. coli. |
CNY 4020.00 |
